KEGG   Cyanothece sp. PCC 8802: Cyan8802_0791Help
Entry
Cyan8802_0791     CDS       T00968                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cyan8802_0791
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Cyan8802_0791
Enzymes [BR:cyh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Cyan8802_0791
Two-component system [BR:cyh02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Cyan8802_0791
Bacterial motility proteins [BR:cyh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Cyan8802_0791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
798892..799995
Genome map
AA seq 367 aa AA seqDB search
MIKVLLVEDSPVALTLLKRMLTSNDQTEVVGTARTGIEALELIPKVNPDVICTDIYMPQM
DGLEFTSQVMAKYPRPILVISAGVQNKDTQEVFAILDAGAVDVFPKPAGGLGVDYEVTKK
QLINKIKVLSGIKVFTKIRRTTASIMLTKSSISTPETRLSSVVSSSDPDKIRVVAIAAST
GGPHAFQEIFSSLTPNFPVPILCVQHISEGFLQGFLNWLKTVCSLRVEIAEHQQVPQPGK
IYFPPEHRHLQIDAQGRFNCTLSPPVDGHCPSATALFESVAQFYGKESVGILLTGMGRDG
ARGLLKIAQAGGLTIAQDESTSVVFGMPQEAIKLGATKTVLPIQEIAPLLINKLMINTKV
IAKKPGN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagttcttttagttgaagattctccggttgctttaactctcctaaaaaggatg
ttaacgtctaacgaccaaacggaagtagtcgggacggctcgaaccggaattgaagcctta
gaattgattccaaaagttaatcctgatgtcatctgtactgatatctatatgccccagatg
gatggcttagaatttacctcgcaagtgatggcaaaatatccacgacctattttagtgatt
agtgcgggggttcaaaataaagatactcaggaagtttttgccattcttgatgcgggtgca
gtcgatgtttttcctaaaccagcagggggattaggggttgattatgaggtaacgaaaaaa
caattaatcaacaaaattaaagtgctttctgggataaaagttttcacgaaaatacggcga
acaactgcttcaataatgctgacaaaatcgagcatttctacccctgaaactcgactttct
tctgtcgtttcgtctagtgatcctgataagattcgcgtggtggctattgctgcttctaca
gggggaccccatgcgtttcaagaaatttttagttctctgactcccaattttcctgttcct
attttgtgtgttcagcatattagtgaaggctttctccaaggatttttaaattggctaaaa
accgtttgttctttaagggttgaaattgccgaacatcaacaagtaccccaacctggaaag
atttattttcctcccgaacatcgtcacctacaaattgacgctcaaggccgatttaattgt
actttgtctcctccagtggatggtcactgtccttcagcaacagctttgtttgaatctgtt
gctcaattttatggcaaagaaagtgtggggattttgttaacagggatgggaagagatgga
gctaggggactgttaaaaatcgctcaggcaggaggattaactattgctcaggatgagtca
acttctgtggtgtttggaatgcctcaagaagccattaaattaggagcaactaagaccgtt
ttacctattcaagagattgctcctttactgatcaataaactaatgataaataccaaggtt
attgcaaaaaaaccagggaattag

DBGET integrated database retrieval system