KEGG   Cyanothece sp. PCC 8802: Cyan8802_0910Help
Entry
Cyan8802_0910     CDS       T00968                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyan8802_0910
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Cyan8802_0910
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cyan8802_0910
Enzymes [BR:cyh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Cyan8802_0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
926908..928377
Genome map
AA seq 489 aa AA seqDB search
MIDLKPLTIGPILGYVTDRSARIFGRGEYVPSPHILPVNLGVQSYQLFESSWGAARFREK
GSSEFNLPQFFKLNPNADMSGVVTFENLKPDTHYEYEIGWFIGETEPEIAVSINWSGAIK
QHFKSGTNNGQEPRSFVYGACRYMQRLAPGIWRYGEDGDKTFGTILKQIEDGLAIDALLM
VGDQIYADDNFTEVTDQDLTVERYFDRYRNTFGQPAIRQLMGQVPTYMTLDDHEILDNWP
KDAGDRQWTLIYPAAIQAYETYQLSHSPLFASPDIDEEERHTGEWGYCRLWYQFQDGCCD
FFALDCRTERELGDTPETRAMLGSRQMEALKKWLCDGSGRIKFVITSVPFFPDKLSGGGL
DQDKWGGFLKQRTELLDLIFERDLKRVVFLAGDVACGMSAEVYCPEKPDFKVVSVISSGL
FWPFTHRAAKHFQMNGKLATLSSHQYELVHCGPVVSIDHFTRINANLDGLIVEMFSSTGR
PCGRKIHEF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgattgacttaaaacccctgactatcggaccgattttaggctatgttactgatagaagt
gcgcgtatttttgggcgaggagaatatgtcccttcaccccatatccttcccgtgaattta
ggcgtacaatcctatcaattattcgagtccagttggggggctgctcgcttccgagaaaaa
gggagttcagaatttaatctgccccaatttttcaaactcaatcctaacgctgatatgtca
ggagtggttacatttgaaaacctgaaacccgacacccattatgaatacgaaatcggttgg
tttattggggaaactgaaccagaaattgcagttagtatcaattggtcaggagccattaaa
caacactttaaatccggtactaataatggccaagagcctcgttcttttgtttatggtgcg
tgtcgttatatgcaacgactcgcccctggaatttggcggtatggagaggatggcgataaa
acctttgggacaattctcaaacaaattgaagatggcctggcgatcgatgccttattaatg
gtaggcgatcaaatttatgctgatgataattttaccgaagtaacggatcaagatttgacc
gttgagcgatattttgaccgctaccgcaatacctttggtcaacctgccattcgtcaactg
atgggacaagtccccacctacatgaccctagatgaccacgaaattctcgataattggcct
aaggacgcaggggacagacaatggacgctgatctatcccgcagctattcaagcttacgaa
acctaccaattaagccatagtcctctgtttgcttcccccgacatcgatgaagaagaacgc
catactggggaatggggatattgtcgtctttggtatcagtttcaggatggttgctgtgac
ttttttgccctagactgtcgcaccgaacgagagttaggggatacgccagaaactcgcgct
atgttggggtccaggcaaatggaagccctgaaaaaatggctctgtgatggctcaggacgc
attaaatttgtgatcacctctgttccgtttttccccgataaattgtcagggggaggactt
gatcaagataaatggggcggttttttgaagcaacggacggaattactcgatttaatcttt
gaacgcgacttaaaacgggtggtctttttagcgggagatgtggcttgtgggatgagtgca
gaggtgtattgtccagaaaaaccggattttaaggtggtttccgtgatctcatcgggttta
ttttggccgttcacccaccgcgcagccaagcactttcaaatgaatggtaagctggcaacg
ctgtcgtctcatcaatatgaattagttcattgtggtccggtggtttcgattgatcatttc
acccgaattaatgccaatcttgatggtttaatcgtagaaatgttttctagtaccggacga
ccctgcggaagaaaaattcacgagttttag

DBGET integrated database retrieval system