KEGG   Cyanothece sp. PCC 8802: Cyan8802_1015Help
Entry
Cyan8802_1015     CDS       T00968                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00330  Arginine and proline metabolism
cyh00332  Carbapenem biosynthesis
cyh01100  Metabolic pathways
cyh01130  Biosynthesis of antibiotics
cyh01230  Biosynthesis of amino acids
Module
cyh_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cyan8802_1015
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Cyan8802_1015
Enzymes [BR:cyh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Cyan8802_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACU99947
JGI: Cyan8802_1015
Position
complement(1040138..1041247)
Genome map
AA seq 369 aa AA seqDB search
MKQTIVIKIGTSSLTQPESGKLALSTIAALVETLTQLRQLGHRIILVSSGAVGVGCSRLN
LKERPKKMAMKQAIAAVGQGRLIRVYDDLFNTLGQPIAQVLLTRRELIERSCYVNASNTF
ESLLELGVIPIVNENDTVAIEELKFGDNDTLSALVASLIHADWLFLLTDVDRLYSADPRL
VPDAKPITLVNSDEFAQLQVKAGDRGSQWGTGGMATKLAAARIATGAGVRTVITHGGKPS
NLLKILQGEAIGTQFEPQTRNDSARKRWIAYGLLPTGKLYLDSGAIRAICHQGKSLLAAG
IIKVEGQFEASEAVQLCDETGQEMARGIVNYNSLEIDKIKGHHSDEISQILGYGGAETVV
HRDNLSVNG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaccattgttataaaaattgggacttcaagtttaacccaacccgaaagcgga
aaattagccctatctaccatcgctgcgttagtcgaaaccttaacccaattacgacaattg
ggacatcgaattattctagtctcttctggggcagttggagtcggttgtagtcgtctaaat
ttgaaagaacgtcccaaaaaaatggcgatgaaacaagcgatcgcagccgtaggacaagga
cgcttaataagggtttatgacgacttatttaacacattaggacaacccattgcccaagtt
ttattaacccgacgggaattaatcgaaagaagttgttatgtcaacgcctctaataccttt
gaatccttgctagaattaggagtaattccgattgttaatgaaaatgataccgttgccatt
gaagagttaaaattcggcgataatgataccttatcagccctggtagccagtttaattcat
gccgactggttatttttattaaccgatgttgatcgcctctattctgccgatcctcggtta
gttcccgatgctaaacccattactctcgtcaatagtgacgaatttgcccaattacaagtc
aaagcaggggatcggggttctcagtggggaacagggggaatggctacaaaattggctgct
gcgcgtattgcaacgggtgcaggagtgagaaccgtcattacccatggaggaaaaccgagt
aatttacttaaaattctgcaaggagaggcgataggaacccaatttgaaccccaaacccgt
aatgatagtgcccgcaaacggtggatcgcctacgggttattacccactggaaaactctat
cttgattctggggcaattcgtgccatttgtcaccaaggaaaatccctattagcagcagga
attatcaaagttgagggacaatttgaagcatcagaagcggttcaattatgtgatgaaaca
ggtcaagaaatggctaggggaattgttaattataatagcttagaaattgataaaattaaa
ggacatcattctgatgaaattagtcaaatattaggctatggaggagcagaaaccgtcgtc
catcgagataatttatcggttaatggatag

DBGET integrated database retrieval system