KEGG   Cyanothece sp. PCC 8802: Cyan8802_1032Help
Entry
Cyan8802_1032     CDS       T00968                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00900  Terpenoid backbone biosynthesis
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01130  Biosynthesis of antibiotics
Module
cyh_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cyan8802_1032
Enzymes [BR:cyh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Cyan8802_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACU99964
JGI: Cyan8802_1032
Position
complement(1056029..1056979)
Genome map
AA seq 316 aa AA seqDB search
MCAMQTYTLMASAKINLYLEIIGDRPDGYHELVMILQSIDLGDRLELRPNGTQTFRLNCS
HPQVPTDNTNLAYRAAQLMKQEFSQAFANYGGVDITLDKHIPVAAGLAGGSTDAAAVLVG
LDLMWELGLTLPELQELGGKLGSDVPFCIAGGTAIATGRGEKLDPIEDIDHLWVVLGKYQ
SLEVSTPWAYQTYRQKFGDAYISDRPAVESRTFKVHSGPLVKAISHKDNTKIGQLLHNDL
EKVVLPEYPQVNHLREVMQQAGGLGTMMSGSGPTVFTLCESQEAAETIKNQARLAIEDAD
LKFWVTKLSSNGIKVL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctatgcaaacctatactttaatggcttcggctaagattaatctttatctggaa
atcattggcgatcgccctgatggctaccatgaattggtgatgatcctgcaaagcattgac
ttgggcgatcgcttagaactccgtcccaatgggacccaaacctttcgcttaaactgttcc
catccccaagtacccaccgataataccaatttagcctatcgagcagcgcaattgatgaaa
caggagtttagtcaagcgtttgctaactatgggggagtagatattaccttagataagcat
attcctgtggctgcagggttagccggggggtcaaccgatgccgccgccgtgttagtcggc
ttagacttaatgtgggaattgggtttaaccttgccagaattacaggaattaggcggaaaa
ctaggctcagatgtccccttttgtatcgcaggaggaaccgcgatcgccacaggacgagga
gaaaaactagaccccattgaagatatagaccatctttgggtagttttaggcaaataccag
agcttagaagtctctactccttgggcttatcaaacctatcgacaaaaatttggagacgct
tatattagcgatcgccctgctgtagagtcccgaaccttcaaggttcattcaggaccttta
gttaaggctatcagccataaagataacacgaaaatcggtcaactattacacaacgattta
gaaaaggtagttttgcccgaatatccccaagtgaaccatcttagagaggtcatgcaacaa
gccgggggactcggaaccatgatgtcaggatcaggtccaaccgtgtttactctctgtgag
tctcaagaagcagcagaaacgattaaaaatcaagcaagactcgctattgaggatgcagac
ctaaaattttgggtgacaaagctatctagcaatggaattaaagtactttaa

DBGET integrated database retrieval system