KEGG   Cyanothece sp. PCC 8802: Cyan8802_1054Help
Entry
Cyan8802_1054     CDS       T00968                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00260  Glycine, serine and threonine metabolism
cyh00750  Vitamin B6 metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01230  Biosynthesis of amino acids
Module
cyh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan8802_1054
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cyan8802_1054
Enzymes [BR:cyh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cyan8802_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACU99985
JGI: Cyan8802_1054
Position
1079488..1080621
Genome map
AA seq 377 aa AA seqDB search
MTVDHLTQQSQPNPVESPKLPPSDLKPWRGLIETYRPYLPVTDTTPVITLLEGNTPLIPV
PYISQQIGRGVKVLVKYDGLNPTGSFKDRGMTMAISKAVENGAKAVICASTGNTSAAAAA
YARRGKMRAFVIIPDGYVALGKLAQALLYGAEVIAIDGNFDDAFKIVRGMAENYPVTLVN
SVNPYRLEGQKTAAFEVVDVLGNAPDWLCIPVGNAGNISAYWMGFCQYHGLGKCDRLPKM
MGFQAAGAAPFLTGQPVPHPETLATAIRIGNPANWNKAWETQKASHGAFNGVTDEEILAA
YRMLASQEGIFCEPASAASVAGLLKVKDQVPSEATVVCVLTGNGLKDPDCAIKHSDNQLK
SGIKADLATVAQVMGFA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgatcatctaacgcaacaatcgcaacctaaccccgtagaatcccctaagctc
cccccttcagacctaaaaccctggcgagggttaattgaaacctatcgcccctatcttcct
gttaccgacacaactcctgtcattaccctacttgaagggaatacccctctaattcccgtt
ccctatatttcccaacaaatcggacggggagtcaaagttttggttaaatacgatggatta
aaccccacgggaagctttaaagatcgcggcatgactatggctatctccaaagccgtcgaa
aacggggctaaagcggttatttgtgccagtacggggaatacctcagcagcagcagcagcc
tacgcgagacggggcaaaatgcgggcattcgtcatcattcctgatggctatgttgccctc
ggaaaactagcccaagctttactttatggggcagaagtgatcgccattgatggcaatttt
gatgatgcctttaagattgttcgagggatggccgaaaattaccccgtaaccttggttaat
tccgttaatccctatcgcttagaggggcaaaaaacggcagcctttgaagttgttgatgtc
ttaggcaatgcccccgactggttgtgtattcccgtggggaatgccgggaatattagtgcc
tattggatggggttttgtcaatatcatgggttaggaaagtgcgatcgcttgccaaaaatg
atgggctttcaagcagccggggctgcaccgtttctaacgggtcaacctgtaccccatcct
gaaaccttagcaactgccattcgtattggcaacccggctaattggaacaaagcttgggaa
acccaaaaagccagtcacggggcgtttaatggtgtcaccgatgaggaaattttagcagcc
tatcgtatgttggcatcccaagaggggattttctgtgagccagccagtgctgcttctgtg
gcaggattattaaaggttaaggatcaagtccccagtgaagcaacggtcgtctgtgtcctg
acgggtaatggacttaaagatcctgattgtgccattaaacacagcgataatcaacttaaa
tcagggattaaggctgatttagctacagttgctcaagtgatggggtttgcgtag

DBGET integrated database retrieval system