KEGG   Cyanothece sp. PCC 8802: Cyan8802_1054Help
Entry
Cyan8802_1054     CDS       T00968                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyan8802_1054
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan8802_1054
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cyan8802_1054
Enzymes [BR:cyh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cyan8802_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
1079488..1080621
Genome map
AA seq 377 aa AA seqDB search
MTVDHLTQQSQPNPVESPKLPPSDLKPWRGLIETYRPYLPVTDTTPVITLLEGNTPLIPV
PYISQQIGRGVKVLVKYDGLNPTGSFKDRGMTMAISKAVENGAKAVICASTGNTSAAAAA
YARRGKMRAFVIIPDGYVALGKLAQALLYGAEVIAIDGNFDDAFKIVRGMAENYPVTLVN
SVNPYRLEGQKTAAFEVVDVLGNAPDWLCIPVGNAGNISAYWMGFCQYHGLGKCDRLPKM
MGFQAAGAAPFLTGQPVPHPETLATAIRIGNPANWNKAWETQKASHGAFNGVTDEEILAA
YRMLASQEGIFCEPASAASVAGLLKVKDQVPSEATVVCVLTGNGLKDPDCAIKHSDNQLK
SGIKADLATVAQVMGFA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgatcatctaacgcaacaatcgcaacctaaccccgtagaatcccctaagctc
cccccttcagacctaaaaccctggcgagggttaattgaaacctatcgcccctatcttcct
gttaccgacacaactcctgtcattaccctacttgaagggaatacccctctaattcccgtt
ccctatatttcccaacaaatcggacggggagtcaaagttttggttaaatacgatggatta
aaccccacgggaagctttaaagatcgcggcatgactatggctatctccaaagccgtcgaa
aacggggctaaagcggttatttgtgccagtacggggaatacctcagcagcagcagcagcc
tacgcgagacggggcaaaatgcgggcattcgtcatcattcctgatggctatgttgccctc
ggaaaactagcccaagctttactttatggggcagaagtgatcgccattgatggcaatttt
gatgatgcctttaagattgttcgagggatggccgaaaattaccccgtaaccttggttaat
tccgttaatccctatcgcttagaggggcaaaaaacggcagcctttgaagttgttgatgtc
ttaggcaatgcccccgactggttgtgtattcccgtggggaatgccgggaatattagtgcc
tattggatggggttttgtcaatatcatgggttaggaaagtgcgatcgcttgccaaaaatg
atgggctttcaagcagccggggctgcaccgtttctaacgggtcaacctgtaccccatcct
gaaaccttagcaactgccattcgtattggcaacccggctaattggaacaaagcttgggaa
acccaaaaagccagtcacggggcgtttaatggtgtcaccgatgaggaaattttagcagcc
tatcgtatgttggcatcccaagaggggattttctgtgagccagccagtgctgcttctgtg
gcaggattattaaaggttaaggatcaagtccccagtgaagcaacggtcgtctgtgtcctg
acgggtaatggacttaaagatcctgattgtgccattaaacacagcgataatcaacttaaa
tcagggattaaggctgatttagctacagttgctcaagtgatggggtttgcgtag

DBGET integrated database retrieval system