KEGG   Cyanothece sp. PCC 8802: Cyan8802_1129Help
Entry
Cyan8802_1129     CDS       T00968                                 

Gene name
purN
Definition
phosphoribosylglycinamide formyltransferase
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cyh00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cyh00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1160117..1160761)
Genome map
AA seq 214 aa AA seqDB search
MKNFVTPSLISPQLSPEELVLDCPLRLGVLASGSGTNFECIVKAIHQGKLKAEIPILIYN
NPEASVKERAQRLNVPAKLLNHRHFKQREDLDQAIVEIFREYQVEWVIMAGWMRIVTHVL
LDAYPNHVINIHPSLLPSFKGIKAVEQALAAQVKITGCTVHIASSEVDSGPILLQAAVPI
LADDTPETLHARIQVQEHLIFPQAIALAAKGEKK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttgtgactcctagcttaatctctcctcaattatctcctgaagaactggtg
ttagattgtcctttaagattaggcgttttagcatcaggaagcgggacaaattttgagtgt
attgttaaagccatccatcagggaaaactcaaagcagaaatccccatattaatctataat
aatcccgaagccagtgtcaaagaaagagcccaacggttaaacgttcccgcgaaattactg
aatcatcgccacttcaaacaacgagaagatttagatcaagccattgttgaaatctttcga
gagtatcaagtagaatgggtcattatggcgggttggatgagaattgtcacccacgtttta
ttagacgcttatcccaatcatgtcattaatattcatccgagtttattacccagttttaaa
gggattaaagccgttgaacaagcattagcagcccaagtcaaaattacgggatgtaccgtt
cacattgccagttcagaagtcgatagcggaccgattttattacaagccgccgttcccatt
ttagctgatgataccccagaaacattacacgcacgtattcaagtacaagaacatcttatt
tttccccaagccattgccttagcagcaaaaggagagaagaaataa

DBGET integrated database retrieval system