KEGG   Cyanothece sp. PCC 8802: Cyan8802_1176Help
Entry
Cyan8802_1176     CDS       T00968                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:cyh00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1201009..1201557
Genome map
AA seq 182 aa AA seqDB search
MAILQLENGTTYIQLDDITRELAPLKVKLNYWTVGEDRKLGNLLDKESLSEEEKEDVLQR
LDHYFQQLKEKDGYQSRDLIVLHRNIPNLDDLLAKFERCHTHRDDEVRYIIDGEGVFGFV
RPDGSQVELTVQAQEYVNVPANTEHWFHLTATKRIKAVRYFTSTEGWTPEYTGTEIRFLT
RV
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggccattttacaattagaaaacgggacaacttatatccaacttgacgatattactaga
gaactcgctcccttaaaggttaaacttaattattggacggtcggagaagacagaaaactt
ggtaatttgctagacaaagaaagtttaagtgaggaagaaaaagaagacgttttacaaagg
ttagatcactattttcaacaattaaaagaaaaggatggttatcagtcgagggacttaatt
gttcttcatcggaatattcctaatctcgatgatcttttagctaaatttgaacgatgtcac
acccatcgggatgatgaagtgcgttatattattgatggtgagggcgtatttgggtttgtt
cgtcccgatggttctcaagttgaattaacggttcaagctcaagaatatgtcaatgttcct
gccaatactgaacactggtttcatctaaccgctacaaagcgcattaaagccgttcgttat
ttcacttcaaccgaaggatggactcctgaatatacagggacagaaattcgttttttaacg
agagtctaa

DBGET integrated database retrieval system