KEGG   Cyanothece sp. PCC 8802: Cyan8802_1215Help
Entry
Cyan8802_1215     CDS       T00968                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cyan8802_1215
Enzymes [BR:cyh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Cyan8802_1215
Exosome [BR:cyh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cyan8802_1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1234244..1235746
Genome map
AA seq 500 aa AA seqDB search
MPKTPSQYILALDLGTTGNRAILFNHQGEIAGQSYQELTQYYPHPGWLEHDAIEIWQDTC
NIIKKVLKTTNIDITAIAAIGLTVQRETCLLWDKTTGKPLHNAIVWQDRRTASHCRQLQK
QGKSVEITQKTGLIVDPYFSATKLTWLLDWVNANNPSVDLKNVIAGTIDAWILWNLTGGQ
VHATDHSNASRTMLMNLDTRTWDQDLLALFGIPEMIMPKIRPSLSYFGETDPQLFGAKIP
ITAIFGDQQAALFAHGCNRPGLLKCTYGTGSFLIIQAGTQVMRSHHQLLSTVAWTTENSA
YYALEGAIFTSGAAIQWLRDGLKIINSATETETLSRQVTDTNGVYFVPALSGLGAPHWDM
NARGAFFGITGGVGREHLVRAVLEAIAYQVKEVVDAINLESTLKVAALKVDGGASQNDFL
MQFQADALGVPIERPLILDATAQGAAFGAGLTVGFWDDYDSLIASRIIDKIFEPGENREQ
VQANFIPWQRAVERGKNWVH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaactccctctcaatatattcttgccttagacttaggaaccaccggaaaccgt
gctattttatttaatcaccaaggagaaatagcaggtcaatcttatcaagaattaacccaa
tattacccccatccaggctggttagaacacgatgcaatcgaaatctggcaagatacctgc
aatattatcaagaaagtcttaaaaacgactaatattgatattactgcgatcgccgctatt
gggctaacagtacagcgagaaacctgtctattatgggacaaaaccacgggaaaaccgcta
cataacgctattgtctggcaagatcgtcgcaccgcttcccactgtcgtcaactgcaaaaa
caagggaagtccgtagaaattacgcaaaaaaccggactgattgtcgatccctacttctct
gctaccaaactaacatggctgctcgattgggtcaacgccaataacccctcagttgaccta
aaaaacgtcattgcagggacaatagatgcttggatactctggaaccttacaggaggtcaa
gtccacgctaccgaccattctaacgcctctcggacgatgttaatgaacctagatacccgt
acttgggatcaggacttattggccttatttggcattcctgagatgattatgcccaaaatt
cgtccgagtctcagttattttggcgaaactgacccccagttattcggggcaaaaattccg
attactgctatttttggggatcaacaggctgctttattcgcccatggttgcaaccgtcca
gggttactcaaatgcacctacgggacgggatctttcttgattatacaggcgggaacacaa
gtgatgcgctcccatcatcaactgctgtctactgttgcttggactacggaaaattccgcc
tattatgccctagaaggagctatttttacctctggggcagctattcaatggctgcgtgat
ggactcaaaattatcaacagcgcgacggaaaccgaaaccctatcgcgtcaagtcaccgat
accaatggggtctattttgtccccgcgttgagtggtttaggggctccccactgggatatg
aacgcgcggggggcatttttcggcattacggggggtgtagggcgagaacacctcgttagg
gcggttttagaggcgatcgcttatcaagtcaaagaagtggtcgatgctatcaatttagag
tctaccctaaaagttgctgcgttaaaagttgatggaggtgcatctcaaaatgatttttta
atgcagtttcaagcggatgcgttaggggttccgatagaacgtcccttgattttagatgct
actgcacaaggggctgcttttggggcagggttaacggttggtttttgggatgattatgat
agtttgattgccagtcgtatcattgataaaatttttgaaccaggcgaaaatcgcgagcaa
gtacaagctaattttattccttggcaacgggcagttgagcgagggaaaaattgggttcat
tga

DBGET integrated database retrieval system