KEGG   Cyanothece sp. PCC 8802: Cyan8802_1215Help
Entry
Cyan8802_1215     CDS       T00968                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cyh00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1234244..1235746
Genome map
AA seq 500 aa AA seqDB search
MPKTPSQYILALDLGTTGNRAILFNHQGEIAGQSYQELTQYYPHPGWLEHDAIEIWQDTC
NIIKKVLKTTNIDITAIAAIGLTVQRETCLLWDKTTGKPLHNAIVWQDRRTASHCRQLQK
QGKSVEITQKTGLIVDPYFSATKLTWLLDWVNANNPSVDLKNVIAGTIDAWILWNLTGGQ
VHATDHSNASRTMLMNLDTRTWDQDLLALFGIPEMIMPKIRPSLSYFGETDPQLFGAKIP
ITAIFGDQQAALFAHGCNRPGLLKCTYGTGSFLIIQAGTQVMRSHHQLLSTVAWTTENSA
YYALEGAIFTSGAAIQWLRDGLKIINSATETETLSRQVTDTNGVYFVPALSGLGAPHWDM
NARGAFFGITGGVGREHLVRAVLEAIAYQVKEVVDAINLESTLKVAALKVDGGASQNDFL
MQFQADALGVPIERPLILDATAQGAAFGAGLTVGFWDDYDSLIASRIIDKIFEPGENREQ
VQANFIPWQRAVERGKNWVH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaactccctctcaatatattcttgccttagacttaggaaccaccggaaaccgt
gctattttatttaatcaccaaggagaaatagcaggtcaatcttatcaagaattaacccaa
tattacccccatccaggctggttagaacacgatgcaatcgaaatctggcaagatacctgc
aatattatcaagaaagtcttaaaaacgactaatattgatattactgcgatcgccgctatt
gggctaacagtacagcgagaaacctgtctattatgggacaaaaccacgggaaaaccgcta
cataacgctattgtctggcaagatcgtcgcaccgcttcccactgtcgtcaactgcaaaaa
caagggaagtccgtagaaattacgcaaaaaaccggactgattgtcgatccctacttctct
gctaccaaactaacatggctgctcgattgggtcaacgccaataacccctcagttgaccta
aaaaacgtcattgcagggacaatagatgcttggatactctggaaccttacaggaggtcaa
gtccacgctaccgaccattctaacgcctctcggacgatgttaatgaacctagatacccgt
acttgggatcaggacttattggccttatttggcattcctgagatgattatgcccaaaatt
cgtccgagtctcagttattttggcgaaactgacccccagttattcggggcaaaaattccg
attactgctatttttggggatcaacaggctgctttattcgcccatggttgcaaccgtcca
gggttactcaaatgcacctacgggacgggatctttcttgattatacaggcgggaacacaa
gtgatgcgctcccatcatcaactgctgtctactgttgcttggactacggaaaattccgcc
tattatgccctagaaggagctatttttacctctggggcagctattcaatggctgcgtgat
ggactcaaaattatcaacagcgcgacggaaaccgaaaccctatcgcgtcaagtcaccgat
accaatggggtctattttgtccccgcgttgagtggtttaggggctccccactgggatatg
aacgcgcggggggcatttttcggcattacggggggtgtagggcgagaacacctcgttagg
gcggttttagaggcgatcgcttatcaagtcaaagaagtggtcgatgctatcaatttagag
tctaccctaaaagttgctgcgttaaaagttgatggaggtgcatctcaaaatgatttttta
atgcagtttcaagcggatgcgttaggggttccgatagaacgtcccttgattttagatgct
actgcacaaggggctgcttttggggcagggttaacggttggtttttgggatgattatgat
agtttgattgccagtcgtatcattgataaaatttttgaaccaggcgaaaatcgcgagcaa
gtacaagctaattttattccttggcaacgggcagttgagcgagggaaaaattgggttcat
tga

DBGET integrated database retrieval system