KEGG   Cyanothece sp. PCC 8802: Cyan8802_1465Help
Entry
Cyan8802_1465     CDS       T00968                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyan8802_1465
Enzymes [BR:cyh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Cyan8802_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1502937..1503422
Genome map
AA seq 161 aa AA seqDB search
MVQSAIALGSNLGDSLSILNESLNLISQSPEIDLKACSSWYRTVPIGPPQPNYLNGCAIL
ETNLSPEKLLQILLKIEQHFGRIRREKWGPRTLDLDLLLYNDLILETDHLQIPHPRMLDR
AFVLVPLVQIAPTWVHPVTQKTIIELLDGVDCSGVSLDLTP
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggttcaatccgcgatcgctctagggagtaatttaggagactcccttagtattttaaat
gaaagtcttaacttgatttctcagtcccctgaaatagaccttaaagcttgttcttcatgg
tatcgaacggttcctattggaccaccccaacccaactatcttaacgggtgtgccatcctt
gaaaccaatttatctcctgaaaaattattacaaattctgctgaaaatagagcagcacttt
ggacgaatacgacgcgaaaaatggggaccgcgaaccttagatttagatttgctgttatat
aatgatttaattcttgagacagatcacctgcaaattccccatccccgaatgctagatagg
gcttttgttttagtccctttggtacaaattgccccgacttgggtacatccagtgactcaa
aaaacgatcattgaactccttgacggggtagactgttctggagtaagtcttgatctaacc
ccctaa

DBGET integrated database retrieval system