KEGG   Cyanothece sp. PCC 8802: Cyan8802_1518Help
Entry
Cyan8802_1518     CDS       T00968                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyan8802_1518 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan8802_1518 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan8802_1518 (trpA)
Enzymes [BR:cyh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cyan8802_1518 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1560653..1561456
Genome map
AA seq 267 aa AA seqDB search
MTSVSDCFQSLRDRRQCALIPFITAGDPDLETTAKALRLLDASGADLIELGVPYSDPLAD
GPVIQAAATRALGRGVKLEDVLGVVKEVSPEIKAPIILFTYYNPIFYRGVEAFLQQVKAA
GVQGLVVPDLPLEEAESLLKPAHEVGIAVTLLVAPTSPIERIEAIARQSQGFIYLVSVTG
VTGMRSQVTSRVKELLTSLRSATDKPIGVGFGISKPEHALQVKNWGADAVIVGSAMVKRL
AEGTPEEGLKAIGAFCQDLKQALKEDQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagtttcggattgtttccaatctctgcgcgatcgcagacaatgcgccttgatt
ccctttattacggcgggtgatcctgatttagagacaaccgccaaagccctgcggttactg
gatgcgtcaggggcagatctgattgaattaggtgttccctattctgatcccttagctgat
ggtccggtgatccaagcggcggctactcgcgccttaggtcggggggtaaaattggaagat
gtcttaggggtggttaaggaggtttctcctgagattaaggctccaattattctatttact
tactacaatccgattttttatcgcggtgtggaagcctttttgcaacaggtgaaagcagca
ggagtccaaggcttagttgtccctgatttgcccctagaagaagccgagagcctcttaaaa
cccgcccatgaggtggggatagcagtgaccctcttggtagccccgacgagtccaatagaa
cgcatcgaagcgatcgctcgtcaatcccaaggatttatctacttagtgagtgttacgggg
gtcacggggatgcgatctcaggtaactagtcgcgtcaaagaattgctgacgagtctgcgg
agtgccacggataaacccattggggtaggttttggtatttccaaaccggaacacgcccta
caggtcaaaaattggggtgcagacgcggtgattgtgggtagtgcgatggttaaacgctta
gcggaaggaacccccgaagaaggattgaaggctattggtgcattttgtcaggatttgaaa
caagcactcaaagaggatcaataa

DBGET integrated database retrieval system