KEGG   Cyanothece sp. PCC 8802: Cyan8802_1694Help
Entry
Cyan8802_1694     CDS       T00968                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cyan8802_1694
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan8802_1694
Enzymes [BR:cyh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Cyan8802_1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1730231..1732639)
Genome map
AA seq 802 aa AA seqDB search
MVATPERPTLEQTPLSAEELRQIQAYWRACNYLAVGMIYLRDNPLLKDPLTEDHVKNRLL
GHWGSSPGLSFIYIHLNRLIKKYGLDVIYMAGPGHGAPGILGPVYLEGTYSETYPDKSED
EEGMKKFFKQFSFPGGIGSHCTPETPGSIHEGGELGYSLSHAYGAALDNPDLIVAAVVGD
GEAETGPLATAWHSNKFINPIRDGAVLPILHLNGYKIANPTILARISHEELEYLFKGYGY
KPYFVEGSDPEVMHQKMAATLETAIAEIKHIQQEARTSGVAKRPIWPMIVLRSPKGWTGP
ASVDGKKTEDFWRSHQVPLSGMHGNPAHIKVLEDWLKSYTPEELFDENGTLIPELKELAP
TGHHRMSANPHANGGLLRKDLKMPDFRNYGVEVAKPGTVEVGNTALLGNFLRDVMANNMT
NFRVFGPDETASNRLNAIYEISKKVWMGEILPEDADGTEITTDGRVMEMLSEHTLQGWLE
GYLLTGRHGFFHTYEAFAHVVDSMFNQHAKWLDICKNEVPWRASVSSLNILLSSTVWRQD
HNGFSHQDPGYVDLVTNKSADVVRVYFPPDANCLLSVANHCLKSTDYVNVIVSDKQIHLQ
YLNMDQAIKHCTKGIGIWDWASNDDCGTEPDHPDVIMASCGDVATKEALAATAILREEFP
DLKVRFINVVDLFKLQSEIEHPHGLSDRDFDNLFTKDKPIIFNFHGYPWLIHKLTYRRTN
HHNLHVRGYKEKGNINTPLELAINNQIDRFNLVIDVINRVPKLGSAAAYVYERMKNAIIE
HRAYAYEHGIDKPEINNWKWPH
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggtagccacacccgaaagaccaactttagaacaaactcccctttctgcggaagaattg
cgtcaaattcaggcttactggcgagcttgtaattatcttgctgttggtatgatctatttg
cgggataatcctttacttaaagaccctttaacagaagaccacgttaaaaaccgcttatta
ggccattgggggtctagtcctgggttaagcttcatttatattcacctcaaccgactgatt
aaaaaatacggacttgatgttatttatatggcaggacctggacacggtgccccaggaata
ttaggacccgtttatcttgaaggaacctactccgaaacttaccccgataaaagcgaagac
gaagaggggatgaagaagttctttaaacagttttctttccctgggggtattggtagccat
tgtaccccagaaacccctggatcaattcatgaaggaggagaattaggctatagtctttcc
catgcttacggtgctgccttagataaccccgatctcattgtagctgcggtggtcggggat
ggagaagccgaaaccggaccgttagccactgcttggcattctaacaaattcattaaccct
atccgtgacggtgctgttttaccgattttacacctcaatggttataaaatcgctaatccg
accattttagcccgtattagccacgaagaattagaatacctcttcaaagggtatggttat
aaaccctacttcgttgaagggtctgaccccgaagtgatgcaccaaaaaatggccgcgact
ttggaaactgcgatcgcagaaattaaacacattcaacaagaagcacgcaccagtggagtc
gctaaacgtcccatctggccgatgattgtgctacgctctcctaaaggatggacaggacct
gcctcagtggacggcaaaaaaaccgaagatttttggcgatcgcaccaagtccccttatca
ggaatgcacggcaaccctgcacacatcaaagtcctcgaagactggttaaagagttacaca
cctgaagaactctttgatgagaacggaacccttattcccgaattgaaagaactcgcaccc
acgggacaccatcgcatgagtgccaacccccacgctaacgggggtttattgcgtaaagac
ctaaaaatgcctgattttcgtaattatggggtagaagttgccaaaccaggaaccgtagaa
gtgggaaatacggctttattggggaattttctacgggatgtcatggccaataatatgacc
aatttccgcgtttttggtccggatgaaaccgcatctaaccgtctcaatgctatctacgaa
atcagtaaaaaagtctggatgggtgagatcttacctgaagatgcggacggaacggaaatt
actaccgatggacgggtcatggagatgttaagcgaacataccctccaaggatggttagaa
ggctatttattaacgggtcgtcatgggtttttccatacctacgaagcatttgctcatgta
gtggactccatgtttaaccaacacgcaaaatggctggatatctgtaaaaatgaggttccc
tggcgtgcttctgtctcttctttgaatatcttactctcttcgacagtttggcgacaagat
cacaacgggtttagtcatcaagatccagggtacgttgatctggttactaataaaagtgca
gacgtggttcgcgtatactttccccccgatgctaactgtttattatcagtagctaatcac
tgtttaaagagcacagactacgttaatgtcatcgtctctgataaacagatacacctgcaa
tatttgaacatggatcaagccatcaaacattgtaccaaaggcattgggatttgggattgg
gcgagtaatgatgattgtggcacagaaccggatcatcctgatgtgattatggcctcttgt
ggtgatgttgccacgaaggaagctttagcggcaacggctattttacgcgaagaatttcct
gatttgaaagtgcggtttattaacgtcgtagacttgtttaaattacagtctgaaatagaa
catcctcacggactttcagatcgagattttgataacttgtttaccaaagataagcccatt
attttcaattttcatggctatccttggttaattcataagttaacctatcgtcgcaccaat
caccataatctccatgtacgcggttacaaggaaaaggggaatattaatactcccttagaa
ttggcgattaataatcaaattgaccgctttaatttggtgattgatgttattaatcgtgtg
cctaaattgggatcagcagcagcctatgtttatgaacgcatgaaaaatgcgattattgaa
catcgcgcctatgcctatgaacatggtatcgataaaccagagattaataactggaaatgg
cctcattaa

DBGET integrated database retrieval system