KEGG   Cyanothece sp. PCC 8802: Cyan8802_1708Help
Entry
Cyan8802_1708     CDS       T00968                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyan8802_1708
Enzymes [BR:cyh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cyan8802_1708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1747482..1748987)
Genome map
AA seq 501 aa AA seqDB search
MTSFQRTSGILLHPTSLPSRFGIGDLGEGAYRFIDFLAASGQTLWQILPLGPTGYGNSPY
LSYSSLAGNPLLISPDILQGEGLLTQDEINGIHGFPADYVDYDRVIQTKLPLLKKASDRF
QHLASPKLKEAFKTFCDRHAQWLDDYALYMSIHAANPEKAWNQWDKDIAERQPQAVQAYT
ERFSEDIFYHKFLQFEFFRQWQDVKKYANERNIRIFGDIPIYVAYDSVDVWANADMFCLN
EKTKEAALMAGVPPDYFSATGQLWGNPVYNWQKLQGTNFQWWIQRFKSTLEYVDIVRIDH
FRGFEAYWAVPEGEKTAMNGKWIKAPGRQFFERLKQELGQLPIVAEDLGVITPEVEALRD
DFGFPGMKILHFAFDSDRVNPFLPYNYVKNCVVYTGTHDNNTTVGWFEGRNQEEKRRVTD
YLGCVSHEGIHWSLIRLAMGSVADLAIFPLQDLLGLHQNGRMNTPGLAEGNWGWRYQSHV
LNQDLVNHLRFVTELYGRLVK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttttcaacgaaccagtggaattttactgcatccaacctctttacccagtcgt
tttggcattggcgacttaggagaaggagcttatcgcttcattgatttcttagcggcaagt
ggtcaaaccctatggcaaattttaccccttggtccaacgggatacggcaattccccttat
ctgtcctattcttccttagctggtaatcccttactcattagtcccgatattttacaagga
gagggattactcacccaagacgaaatcaatggaatccatggatttccagcagattacgtc
gattatgaccgagtgattcaaaccaaattgcccctactcaaaaaagcgagtgacagattt
caacatctagcctcaccgaagctaaaagaagccttcaagacgttttgcgatcgccacgcc
caatggttagacgactacgcactctatatgtctatccatgcagctaacccggaaaaagct
tggaaccagtgggacaaagatatcgccgaacgccaacctcaagcggttcaagcttacacc
gaacggttcagcgaagatattttctatcataaattcctacaatttgaatttttccgtcaa
tggcaggatgtcaaaaaatacgccaatgaacgcaacatcaggatttttggcgatattcct
atctatgttgcctatgacagtgtggatgtttgggctaatgctgatatgttttgcctgaac
gaaaaaaccaaagaagcagctttgatggcaggcgttccccccgattattttagtgccaca
ggtcaactttgggggaatccagtctacaattggcaaaaactccaaggaactaacttccaa
tggtggattcaacggtttaaatcgaccctagaatatgtagacatcgttcgcatcgatcat
tttcggggatttgaagcctattgggcagttcccgaaggagaaaagactgcaatgaatgga
aaatggataaaagccccaggacgacaattctttgaacggcttaaacaagaattgggacaa
ttacccatcgtcgctgaagatttaggggtgattaccccagaagtggaagccctacgggat
gattttgggtttccaggcatgaaaatcttgcattttgcctttgatagcgatcgcgttaat
cctttcttgccttacaattacgttaaaaattgtgtggtttataccggaacccacgacaac
aatacgacagtgggatggtttgaaggacgcaatcaggaagaaaaacgcagagtcaccgat
tatttaggctgtgtttcccatgaaggtatccactggagtctcattcgcttagccatgggg
tcagtcgctgacctagctatctttcccctgcaagacctcttaggattgcatcagaacgga
cggatgaatacccctggactagctgagggtaactggggatggcgatatcagtcccatgtc
ttaaatcaagacttggttaaccatttacggtttgttaccgaactctacggtcgtctggtt
aagtaa

DBGET integrated database retrieval system