KEGG   Cyanothece sp. PCC 8802: Cyan8802_2055Help
Entry
Cyan8802_2055     CDS       T00968                                 

Definition
sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cyh  Cyanothece sp. PCC 8802
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2070483..2071472
Genome map
AA seq 329 aa AA seqDB search
MAIKAFITGGTGFIGANLVRLLLDQGYEVRALVRSQSRLDNLKGLDIELVEGDLNDANLS
EKIRGTNVLFHVAAHYSLYQRDRHQLYQSNVLGTRSVLKAAQQAGIERTIYTSSVAAIGV
GNPSEIVNETHQSPVEKLVGHYKKSKYWAEQEAKKAVQKGQDIVIVNPSTPIGPWDIKPT
PTGEIILRFLRRKMPAYVDTGLNLIDVRDVSWGHLLALEKGKSGERYILGHQNLSLKALL
DQLSSLTGLSAPQRTIPLWLPLTMAWIDESLLTPLGKTPSLPLDGVRMSKSPMYYDGSKA
VKELGLPQSPIKKALQDAITWFIDQGYSY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctattaaagcatttatcacaggaggaaccggatttattggggcgaatttagttcgg
ttattattagaccaaggttatgaagtccgcgcattagtgcgttcccaaagccgtttagat
aacctaaaagggcttgatattgaattagtagaaggagatctcaatgatgccaatttatca
gaaaaaatcagaggaactaacgtcttatttcatgtagccgcccactattccctttatcaa
cgcgatcgccaccaactttatcaaagtaatgttttaggaacccgttccgttttaaaagca
gcccaacaagccggaattgaacgtaccatttacaccagttccgtcgctgctattggcgtt
ggaaacccatcagaaatcgtcaacgaaacccatcaaagtcccgttgaaaaattagtagga
cactacaaaaaatcaaaatattgggctgaacaagaagccaaaaaagccgttcaaaaagga
caagatatcgtcatcgttaaccccagtacccccatcggtccgtgggacatcaaacccact
ccaacaggagagattatcctgcggtttttacgccgtaaaatgcccgcctatgtagatact
ggattaaatttaattgacgtgcgagacgtaagttggggtcatctgttagccttagaaaag
ggtaaatctggagaacgctatattttaggtcatcaaaatctcagtctcaaagccctatta
gaccaattatccagcctcactggattaagtgcaccccaaagaactatccccttgtggcta
cccctaaccatggcatggattgacgaatcccttcttactcctttaggaaaaaccccgtcc
cttcccttagatggcgttcggatgtctaagtcaccgatgtattacgatggatcaaaagcc
gtcaaagaattagggttgccccaatcacctattaaaaaagccctccaagatgcaattact
tggtttatcgatcaaggctattcttattaa

DBGET integrated database retrieval system