KEGG   Cyanothece sp. PCC 8802: Cyan8802_2263Help
Entry
Cyan8802_2263     CDS       T00968                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cyh00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cyh00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2278337..2280754)
Genome map
AA seq 805 aa AA seqDB search
MKTLFSLPNIPPCAWKRPIGQGWDKPYTVRYASNLDDGPNHGMPLGGFGSGCIGRSPSGD
FNLWHLDGGEHVFRSIPSCQFSVFEQPEGEDAQVYALSTQPPEEGTLSRWSWYPPEKGTY
HALYPRSWYQYEGVFKSQLICEQFSPIIPNNYQETSYPIGIFEWTAHNPTDKPITLSIMV
TWQNIVGWFTNAIKSPEITVRDDGSPEYQYQPRWGDSTGNFNQWVQDNFRVGFILNRIQL
HDQIQEGEGQICIASVTNPSVEVFYLGKWNPKGDGSEVWDYFAMNGSLPDTEDETPAEPG
EQIAVAMAIRFTIRPGRTKKIPFILAWDFPVTEFAPGVQYYRRYTDFYGRNGKNGWAMVR
TALKHSDVWYERVEEWQSPILKREDLPDWFKMALFNELYLLTDGGTLWTAASENDPVGQF
GVLECLDYRWYESLDVRLYGSFGLMMLWPRLEKSVLEAFARAIPTHDDTPRIIGYNQAKA
IRKAKGATPHDLGAPNEHPWQKTNYTSYQDCNLWKDLGSDFVLQVYRDYLLTGSDDTDFL
WECWPAITETLDYLKTFDLDNDGIPENSGAPDQTFDDWKLQGISAYCGGLWIAALEAAIK
IAEILLKNVPTTEELQSRNNPESIKHYVKNHRDWLEQSRSIYHDTLWNGEYYKLDSQSGS
DVVMADQLCGQFYARLLNLPDVVETQYTESALNKVYEACFLKFQDGKYGAANGMKPDGTP
EDPNSTHPQEVWTGINFGLAAFLLQMGRKDAAFKLTEAVVKQVYENGLQFRTPEAITAVG
TFRASHYLRAMAIWGIYGILTHFRP
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattattctctctccccaatattcccccttgcgcttggaaacgccctatcggt
caaggatgggataagccctataccgtccgttatgctagtaatttagacgatggaccgaac
cacggaatgccccttggtggttttggttctggttgtattggacgttctcccagtggtgac
tttaacctgtggcatctggatgggggtgagcacgtttttcgcagcattccatcgtgtcag
tttagcgtctttgaacagccagaaggcgaagatgctcaagtctatgccctatctacccaa
cctcctgaagagggaaccctctcccgttggtcttggtatcccccggaaaaaggaacctat
cacgccctttatccccgcagttggtatcagtatgaaggggtgtttaaaagtcaattaatt
tgtgaacaattttctcccattatccccaataactatcaagaaaccagctatcctatcggc
atttttgaatggactgcccataaccccacggataaacccattaccctgagtattatggtg
acgtggcaaaatattgtggggtggtttacaaatgcgattaaatcccctgaaattactgtt
agggatgatggcagtcctgaatatcaatatcaacctcgatggggagacagtacgggcaat
tttaatcagtgggttcaagataattttcgggtcggttttatccttaaccgtattcaactt
catgaccaaattcaagaaggagaaggacagatttgtatcgctagtgtcactaaccccagt
gtggaggttttttacttaggaaaatggaatcctaaaggggacggatctgaggtttgggac
tattttgccatgaatggttccttaccggatacggaagatgaaaccccggcagaaccgggt
gaacaaattgcggttgcgatggccattcggtttactattcgtccagggagaaccaagaaa
attccctttattttagcctgggatttcccggtaacagaatttgcgccaggggtgcaatat
tatcgccgctatactgatttttatggtcgcaatggtaagaatgggtgggcgatggtgaga
accgctttaaaacattctgatgtgtggtatgaacgggtcgaagaatggcagtctcctatt
ttgaaacgggaggacttacctgactggtttaagatggctttattcaatgaattataccta
ttaacagatgggggaaccctgtggacggctgcttcagaaaatgaccccgtaggacaattt
ggggtacttgaatgtttggactatcggtggtatgaaagtttagatgttcgcttgtatggt
tcctttgggttaatgatgctttggccacgtttagaaaagtctgttttagaagcatttgct
agggcaattcctacccatgatgatacccctagaattattggatataaccaagcaaaagcc
atccgaaaagcgaaaggggcaactccccatgacttaggagcacccaatgaacatccttgg
caaaaaaccaattacactagctatcaagattgtaatttgtggaaagatttaggcagtgat
tttgtgctccaagtatatcgagattatttattaaccgggtcagatgatacggattttttg
tgggaatgttggccagcgattactgaaaccttagactatttaaagacgtttgatttagat
aacgatggcattcccgaaaattcaggagccccggatcaaacctttgatgattggaaatta
caaggaattagtgcctattgtggtgggttgtggatagctgccttagaggcggcgattaaa
atagcagaaattctgctcaaaaatgtgccaactacggaagaattacagtcgagaaataat
cctgaatccatcaagcattatgtcaaaaatcatcgtgattggctagaacaatctcggtca
atttatcacgatacgttatggaatggagaatactacaaactcgatagtcaaagcggttct
gatgtggtgatggcggatcaattatgcggtcaattttacgcccgtttattgaatttaccc
gatgtcgttgaaactcagtatacagaatcagctttaaacaaggtttatgaggcgtgtttt
ttgaagtttcaagatggaaaatatggtgcagctaatgggatgaaacctgatggaactccc
gaagatcctaactcaacccatccccaagaagtttggacaggaattaactttggtttagcg
gcatttttattacaaatgggacgcaaagatgcagcttttaagttaaccgaagctgttgtt
aaacaagtctatgaaaatggcttacaatttcgcactcctgaagcgataacggctgtggga
accttccgtgctagtcattatttacgggcgatggctatttggggaatttatggcatttta
acccattttcgaccctaa

DBGET integrated database retrieval system