KEGG   Cyanothece sp. PCC 8802: Cyan8802_2403Help
Entry
Cyan8802_2403     CDS       T00968                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyan8802_2403
Enzymes [BR:cyh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cyan8802_2403
Exosome [BR:cyh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cyan8802_2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2417407..2419386
Genome map
AA seq 659 aa AA seqDB search
MNNTEAHPNSLFSDFDLYLFGQGQHHKIYEKLGAHPVEFNGTKGVYFAVWAPSAHEVAVI
GDFNHWNRDTHLMKRIEGGNPGIWELFIPNIGVGEKYKFAIKNHHKETVEKTDPYGYQQE
VRPATASIVTDLSYTWDDQDWLEKRAQTNPQEQPVSVYEVHLGSWKHTSWDNQPKNGVPV
GVPYKDNARFLNYRELADELIPYVKEMGYTHIELLPVTEYPFDGSWGYQVVGYYAVTSRY
GTPQDFMYFVDQCHQQGLGVIIDWVPGHFPKDSHGLARFDFTALYEYEDPRKGEHLEWGT
LVFDYGRNEVRNFLMASAIFWFEMYHIDGIRVDAVSSMIYLNYQREPGQWVPNQYGGDDN
IEAVSFLRELNKTIFGYYPGILSIAEEATEWKDVSRPIEGGGLGFNFKWNMGWMNDTLKY
FLINPHDRSSYHNKLTFSLWYAFNENFMLALSHDEVVHGKGHLFQKMGGQGGISDWDRIA
NLRVLFAYMFTHPGKKTLFMGMEFGQTHEWRYNLDLEWFLLDSELHWKLKKLVQDLNTIY
RTEPALYTDDFTPNGFQWIDCHDAGRGMLSFIRKDKFTHEKIVVVCNFKDYDQYNYWLGV
PDHGNYIELINTDSHTYGGSGKGNLSPMHSKQWNTEHFHNALEITVPKFSAIMFKLKRD
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataccgaagcacatccaaatagcttgttcagtgatttcgacctgtatctattc
ggtcagggacagcatcacaagatttatgagaaattaggggcgcatcctgtcgaatttaat
ggaacaaaaggggtttactttgcggtttgggctcctagtgcccatgaggtcgctgttatt
ggcgatttcaaccactggaaccgagacacccacttaatgaaacgaattgaagggggaaac
ccagggatttgggaactttttatccccaatattggcgttggcgaaaaatacaaatttgct
attaaaaatcaccataaagaaacggtggaaaaaaccgacccctatggttatcaacaagaa
gtgcggccagcaacagcttcaattgtcaccgatttatcctatacttgggacgaccaagac
tggttagagaaaagagcccagactaacccccaagaacaacccgtttccgtctatgaagtc
catttaggctcatggaaacataccagttgggataatcaacctaaaaatggagttcccgtc
ggtgttccttacaaggataacgcccgttttctgaattatcgagaattagcggatgaatta
attccctacgtcaaagagatgggttatacccacatcgaactccttccggtaaccgagtac
ccctttgatgggtcttggggatatcaagtggtcggttattatgccgttacttcacggtat
gggactccacaagattttatgtattttgtggatcaatgccatcaacagggattaggagtc
attatcgactgggttcctgggcattttcccaaggatagccatgggttagctcgttttgat
tttaccgccctctatgagtatgaagatccccgtaagggagaacatttagaatggggaacc
ctcgtctttgactatggccgtaacgaggtacgcaatttcttaatggccagtgccattttt
tggtttgaaatgtatcatattgacgggattcgcgttgatgctgtctcttcgatgatctat
ttgaactatcagcgagaacccggccaatgggttcccaaccaatacggaggggatgataat
atcgaggcggtttccttcctgcgggaattgaacaagacgattttcggttattatccaggg
attctctccatcgcagaagaggccacggaatggaaagatgtctctcgtcccatcgaaggg
ggtggactgggatttaatttcaaatggaatatggggtggatgaacgataccctcaaatat
tttctgattaatccccacgatcgctctagttatcacaataaactaacctttagtttgtgg
tacgccttcaatgagaatttcatgctggcactctcccatgatgaagtcgtccatggtaaa
ggccatttattccaaaaaatgggcggtcaaggtggcattagtgattgggacagaattgct
aatttacgggtactctttgcctatatgttcacccatccaggcaagaaaaccctatttatg
ggtatggaatttggccagacccatgaatggcgttacaatctcgatcttgaatggttcttg
cttgattctgaactgcattggaaactgaaaaagttagttcaagatctcaatacgatttac
cgaacagaacctgccctttatacggatgattttacgcctaatggcttccaatggattgat
tgtcatgacgctggccgtggaatgctttcctttatccgtaaagacaagtttacccatgag
aagatcgtagtcgtttgtaactttaaggactatgaccaatataactattggttgggcgtt
cctgatcacggaaactacatcgaattaatcaatacagattctcatacctatggaggaagt
ggcaagggcaatttatcgcctatgcactctaaacaatggaatactgaacatttccacaat
gcgttagaaattacggttcctaaatttagtgcgattatgtttaaactcaaacgagattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system