KEGG   Cyanothece sp. PCC 8802: Cyan8802_2404Help
Entry
Cyan8802_2404     CDS       T00968                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00790  Folate biosynthesis
cyh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyan8802_2404
Enzymes [BR:cyh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Cyan8802_2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACV01277
JGI: Cyan8802_2404
Position
complement(2419453..2420292)
Genome map
AA seq 279 aa AA seqDB search
MTALKLGKYYFNWGQKTYIMGIINVTPDSFSDGGQFNTLETALTQARNLIKSGADILDIG
GQSTRPGSQQIPLEEELNRVIPIIKALRQETTIPISIDTTRSSVAEAAVEAGADLINDIS
GGTFDPEMFPVVARLGVPIVIMHIRGTPQTMQQLTDYGDIIQDISQWLEKQLNLAMKAGI
KRSHLIIDPGIGFAKTYQQNLELLRRLGEFRRLGCPMLVGVSRKSFIGHILQENDPKQRI
WGTAAACCSAIAQKADVLRVHDVAQMVDVCRVADAIWRI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactgcattaaaattaggcaaatattattttaattggggacaaaaaacctatattatg
ggaatcattaatgtaacccccgatagtttcagtgatggaggtcaatttaataccctagaa
acggctttaacccaagctagaaacctaattaagtcaggagcagatatccttgatattggg
ggacaatcaacccgtccagggtcccaacaaattcctctagaagaagaattaaaccgcgtt
attcctattataaaagcgttacgtcaagaaacaacgattcctatttcgattgatacgact
cgatcatccgttgctgaagctgctgttgaagcgggtgcagacttaattaatgatatttct
gggggaacttttgaccccgaaatgtttcccgtggtagcaaggttaggagttcctattgtt
attatgcacattcgcggaacccctcaaaccatgcaacaattgaccgattatggagacatc
atccaagatattagccaatggctagaaaagcaactcaatttagcgatgaaagccggaatt
aagcgatcgcacctgatcattgatccaggtatcgggtttgccaagacctaccaacaaaat
ttagaattattaaggcgtttaggagagtttagacggttaggctgtccgatgttggtggga
gtatcgcgtaaaagctttattggtcatattttgcaggaaaacgacccaaaacaacggatt
tggggaaccgccgcggcctgttgtagtgcgatcgcccaaaaagctgatgttctaagggtg
catgatgtcgcgcaaatggttgatgtctgtcgagttgctgatgctatttggcgaatttaa

DBGET integrated database retrieval system