KEGG   Cyanothece sp. PCC 8802: Cyan8802_2499Help
Entry
Cyan8802_2499     CDS       T00968                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan8802_2499
   01230 Biosynthesis of amino acids
    Cyan8802_2499
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_2499
   00051 Fructose and mannose metabolism
    Cyan8802_2499
   00562 Inositol phosphate metabolism
    Cyan8802_2499
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan8802_2499
Enzymes [BR:cyh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cyan8802_2499
Exosome [BR:cyh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cyan8802_2499
  Exosomal proteins of bladder cancer cells
   Cyan8802_2499
  Exosomal proteins of melanoma cells
   Cyan8802_2499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2524306..2524998
Genome map
AA seq 230 aa AA seqDB search
MHKTQAEALEFLQVLKLELEEADETRGVVLCAPFTALGTMSKSLHGGLIRLGAQNIHWED
SGAYTGEIAGAMLTEIGVEYVVVGHSERRQYFGETDETANLRVIAAQRHGLTPILCVGET
KSQRDAGETETVIINQVKRGLVDVDQRNLVIAYEPIWAIGTGDTCEASEANRVIGLIREQ
LTNKAVTIQYGGSVKPDNIDEIMAQPEIDGALVGGASLDPVGFARIVNYQ
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacacaggccgaagctctggagtttttgcaagtcttgaaattagagctagaa
gaagctgacgaaacgagaggagtggttctctgtgctccgtttactgccttgggaaccatg
tcaaaaagcttacatggtggcttaattcgtttgggagcccaaaatatccattgggaagat
agcggagcctacacaggagaaattgcgggggcgatgttgacagaaatcggggtagaatat
gtggtggttggccacagtgaacgtcgccagtatttcggagaaacggatgaaacagcgaat
ttacgggtgattgcagcgcaacgccatggcttaacccccattctctgtgtgggggaaacc
aagtctcaacgggatgccggggaaacagaaacagtgattattaatcaggttaagcgcggt
ttggtggatgtagaccagcgtaatttagtgatcgcttatgaacccatctgggcgatcggg
actggtgatacctgtgaagcctccgaagctaaccgagtcattggacttattcgagaacaa
ctgaccaataaagcggtaacaattcaatatggaggttccgtcaaacccgacaatattgat
gagattatggcacagccagagattgatggagctttggtgggtggagcgagtttagatcca
gtggggtttgctcgaattgtgaattatcaataa

DBGET integrated database retrieval system