KEGG   Cyanothece sp. PCC 8802: Cyan8802_2604Help
Entry
Cyan8802_2604     CDS       T00968                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan8802_2604
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_2604
   00620 Pyruvate metabolism
    Cyan8802_2604
   00640 Propanoate metabolism
    Cyan8802_2604
  Energy metabolism
   00680 Methane metabolism
    Cyan8802_2604
Enzymes [BR:cyh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cyan8802_2604
Lipid biosynthesis proteins [BR:cyh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cyan8802_2604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2629318..2631312)
Genome map
AA seq 664 aa AA seqDB search
MPENAIESILQEKRLFNPSPEFAENAHIKSLDQYNELYEKAKADPQAFWADLAEKELHWF
KKWDQVLDWQPPFAKWFVGGKLNISYNCLDRHLTTWRRNKAAIIWEGEPGDSRTLTYGEL
HREVCQFANAMKQLGVKKGDRVGIYMPMIPEAAIAMLACARIGAPHSVVFGGFSSEALKD
RLEDAQAKLVITADGGFRKDKAIHLKSAVDLALEHGAPTIEKVIVVERIKEPITMKEGRD
YWWHDLKKTASADCPAEEMDSEDTLFILYTSGSTGKPKGVVHTTGGYNLYTHMTTKWIFD
LKDTDVYWCTADVGWITGHSYIVYGPLSNGATSLMYEGAPRPSNPGCFWDVVEKYGVNIF
YTAPTAIRAFIKAGDELPNARDLSSLRLLGTVGEPINPEAWMWYHRVIGKERCPIVDTWW
QTETGGIMITALPGAIPTKPGSATRPFPGIIADVVNEDGQTVPDNAGGYLVIKHPWPSML
RTVYGNPERFRKTYWDPIAPIDGEQVYFAGDSVRRDEDGYFWIMGRVDDVMNVAGHRLGS
MELESALKSHPAVAEAGVVGTPHEITGEQIFAFVILKNTATPSDELAQELKQHVVMEIGA
IARPGEIQFTEALPKTRSGKIVRRFLRQIAAGQEIVGDKTTVEDPTVLDKLEAEIAQKRA
KAAV
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaaacgccattgaatcgatcctacaagaaaaacggttatttaatccgtcccct
gaatttgctgaaaatgcccatattaaaagcttagaccagtataatgaactatacgaaaaa
gcaaaagctgatccccaagcattttgggcagacttagcagaaaaagaattgcattggttt
aaaaaatgggatcaagttctcgactggcaacccccctttgctaaatggtttgttggcgga
aaattgaacatttcctataactgtctcgatcgccatttaaccacctggagacggaacaaa
gcagccattatctgggaaggggaacccggtgactctcgtacccttacctatggggaactc
catcgagaagtgtgccagtttgccaacgcaatgaagcaattaggggtcaaaaaaggcgac
cgtgtgggaatctatatgcccatgatccctgaagccgcgatcgccatgttagcctgtgcc
cgcatcggtgcgccccatagcgtcgtctttggcggatttagttcagaagccctcaaagat
cgcctagaagatgctcaagctaagttagtcatcaccgcagacggtggatttcgcaaagat
aaagccattcacctcaaatcagccgttgatttagccctcgaacacggagcccccaccatt
gaaaaggtgatcgttgtcgaacgcatcaaagaacccatcaccatgaaagaaggacgggac
tattggtggcacgatctcaaaaaaaccgcctcggctgactgtccggccgaagaaatggac
agcgaagacaccctgtttatcctctacaccagtggcagtacgggaaaacccaagggagtt
gtccacaccaccgggggttacaacctctatacccacatgaccactaaatggatatttgat
ctcaaagataccgacgtttactggtgtaccgccgatgtgggctggatcacaggtcatagc
tacattgtctatggtcccctgtccaatggggcaaccagcttgatgtacgaaggagcccct
cgtccctcaaatcctggctgtttttgggatgtcgtggaaaaatacggcgtaaatatcttt
tatacggctcctacggccattcgtgcctttattaaagcgggagacgaactccccaacgcg
cgggatctctcttcattacggttgttaggaacggtcggcgaacccatcaaccccgaagcg
tggatgtggtatcaccgtgtcatcggaaaagaacgctgtcccatcgtggatacttggtgg
caaacagaaacaggagggattatgattacagccttacctggggcaattcccaccaaaccc
ggctcagcgactcgtcccttccctggtattattgccgatgtggtcaatgaagatgggcaa
accgttcccgataatgcggggggttatttggtgattaaacacccctggccgagtatgctg
cgtaccgtttatggtaatcctgaacgcttccgtaagacctactgggaccccattgcaccc
atcgacggagaacaggtctattttgccggagatagcgtgcgtcgggatgaagatggctat
ttttggattatgggacgggtggatgacgtgatgaacgtcgctggacatcgtttggggtcg
atggagttagaatctgccttaaagtcccatcctgcggtcgctgaagcgggagtggtcgga
actccccatgagattaccggagagcagatttttgcctttgttatcctcaaaaatacagct
acaccgtcggatgaattggcgcaggagttaaaacagcacgttgtcatggaaattggtgcg
atcgctcgtcctggcgagattcaatttaccgaagcactcccgaaaacgcgatcgggtaaa
atcgttcgtcgctttttgcgtcaaattgcagccggacaagaaattgtgggcgataaaacg
acggtagaagatccaacggttttggacaagttagaagcagaaatcgctcaaaaacgagcc
aaagctgcggtttaa

DBGET integrated database retrieval system