KEGG   Cyanothece sp. PCC 8802: Cyan8802_2950Help
Entry
Cyan8802_2950     CDS       T00968                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyan8802_2950
Enzymes [BR:cyh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Cyan8802_2950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2985592..2986011)
Genome map
AA seq 139 aa AA seqDB search
MNHVLLSVGSNINPVENFRAASTILAQEQILVDCTQPIVTKPHGYPHQPDFLNGAFYLKT
TLDLPNLNRLLKTIEKQLGRVKTAIKSGPRTIDLDIIIWNGEIVRDEFYHYEYVYGPISE
LAQKHGIILQAQSVGKVGG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatgttcttctctccgttggctcaaatatcaatccagtcgagaatttccgcgca
gcatcaaccattctggcacaagaacagattttagttgactgcacccaacccattgtgact
aaaccccatggctacccccatcaaccggatttcttaaacggagctttttatctaaaaacg
accctagatctccctaaccttaaccgtttgcttaaaaccatagaaaagcagttaggacgg
gttaaaaccgccattaaatcaggtccgcgtactatcgacctggatattattatctggaac
ggtgagattgttcgagacgaattttatcactatgaatatgtctatggtccaatctctgaa
ttagcacaaaaacatgggattatcctccaagcgcaaagtgtgggaaaagtaggaggctag

DBGET integrated database retrieval system