KEGG   Cyanothece sp. PCC 8802: Cyan8802_2973Help
Entry
Cyan8802_2973     CDS       T00968                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyan8802_2973
Enzymes [BR:cyh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Cyan8802_2973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3002588..3005014)
Genome map
AA seq 808 aa AA seqDB search
MNRKRWLFAPLIALCVACLLATNAAWAVGGGLAPGAPGNPSVWSYAGKQGIGTSYEQYVN
NRYQDGGPTNTISKVWFSLAQGIVTETAYGDIDHAQLKDLQLLVTGNDFLNEERVDTDST
VDYLHKDSDGRPLSPAYRLVNTAKNGKYTIEKHIFTDPDRQTLFTRVIFTANEDNITPYV
LTNPHMNNTGNQDVAFVNADSLNAREGEMVYASIKSSEPFVKTSAGYVGTSDGYQDLSRD
RTMDWTYDYTDESRPGNVAMMAQLPTLNAGETRTFDIVVGFGNTYNAATAQADGSLEEGH
DSLLAKYNGEGSAVGWEDYIASLSNVPAMIPNTGDNGKELYASAFTLKSMEDKTHAGAFI
ASLSVPWGDTVNADSFATGYRAVWPRDFYQVAMALFALGDTQSPLVAFEYLPQVQVTRNT
PGNNGATGWFLQKTHVDGTLEWVGVQLDQTAMPIMLGWRLWKAGILSDSQISDYYRRMLK
PAAEFIANGGQVNIRYPGSSSFNTFDIQPPLTQQERWEEQHGYSPSTTAAEITGLVVAAD
IAQNAANDPGAAAYYLQKADEYQRNVDPKMFTTSGPSTPCSNPGEYFVRITPDGNPNSGS
IINDPNNFSRNDERRILDGGFLELVRYGVLKGNNPDIAETVCALDNTSVSDDARVRYNLS
FDGNQYPGFRRYGFDGYGERVNDGSNFRGQDSNQRGRIWPFFTGERGHYELAAAKANNGG
TISDDQVAQLRDTYVRGMEYFANDGLMIPEQVWDGVGANATHNYTVGEGTNSATPLAWSH
AEYVKLVKSLTDKKIWDSYDIVKARYQN
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaaaacgttggttatttgctcctttgattgccctgtgtgtggcttgcttatta
gcaactaacgccgcttgggcagtaggagggggtctagcccctggagcaccgggaaatccc
tcggtttggtcctatgctggaaaacaaggtatcggaacctcctacgaacagtatgttaac
aaccgctatcaagatggcggacccaccaatactatctctaaagtgtggttttccctcgcc
caaggcattgttaccgaaaccgcttacggagacattgatcacgctcaactcaaagactta
cagttgttagtcaccggtaatgatttcttaaacgaagaaagagtcgataccgatagtacc
gtggactatctccataaggatagcgatggccgccctctatctccagcttatcgcctggtt
aataccgctaaaaacggcaaatacaccatagaaaagcatatctttactgatcccgatcgc
caaaccctatttacccgggttatttttaccgccaatgaagataatattaccccctatgtc
ttgactaacccccacatgaataataccgggaatcaagatgtagcctttgttaacgccgat
agtctcaacgcccgtgaaggggaaatggtctacgccagtatcaaaagtagcgaacctttt
gtgaaaacctcggccggctatgttgggacgagtgatggctatcaagacttaagccgcgat
cgcactatggactggacctatgactacaccgatgagtcccggccaggaaacgtcgctatg
atggctcaattgcccaccctcaacgccggagaaacccgtacctttgacatcgttgtggga
tttggtaacacctataacgcagctaccgcccaagcagacgggtcgttagaggaaggccac
gacagtcttttagccaaatacaacggagaaggatcagccgtgggttgggaagactatatc
gctagtctgagcaatgttcctgctatgatccccaatacgggagataacggcaaagaactc
tacgccagtgcctttaccctaaaaagcatggaagataaaacccatgcgggagcctttatt
gcttctttatcggttccttggggcgataccgtgaatgcggatagctttgccacggggtat
cgtgccgtttggccacgggatttttatcaagtggctatggctttgtttgccctcggtgat
acccaaagtcccttagtagcctttgaatatttaccccaagtccaagttacccgtaatact
cccggcaataacggggcaacggggtggtttttacaaaaaacccacgttgacggaacctta
gaatgggtgggcgtacagttagaccaaacggcgatgccgattatgttgggttggcggtta
tggaaagccgggattttgtctgatagtcaaattagtgattattatcgccggatgttgaaa
ccagcagccgaatttattgccaatggtggtcaagtgaatattcgctatccgggttcttcg
agtttcaacacttttgatattcaacctcccctaacgcaacaagaacgctgggaagaacaa
cacggttattccccgtctaccaccgcagcagaaattactgggttagttgtcgcggctgat
attgctcaaaatgcggctaatgatcctggggctgctgcctattacttgcaaaaagcggat
gaatatcagcgcaatgttgatcctaagatgttcaccacctctggacctagtaccccctgt
agtaatccgggtgagtattttgtccgcattactcccgatggtaatcccaatagtggcagt
atcatcaacgatcctaacaatttcagtcgcaatgatgaacgtcgtatcctagacggcggt
ttcttggaattggtgcgctatggcgttcttaaaggcaataatcctgacattgcagaaacg
gtctgtgctttggacaataccagtgtctcagatgatgcgcgggtacggtacaatttgtcc
tttgatggtaatcagtatccggggttccgacgctatggctttgatggctatggcgaacgg
gttaacgatggtagtaacttccgtggtcaggattctaatcaacggggacggatttggccg
ttctttactggggaacggggtcattatgaactggcagccgctaaagctaataatggcgga
accattagtgatgaccaagtggctcaactgcgtgatacctatgtccgggggatggagtat
ttcgctaatgacggtttgatgattcctgaacaggtttgggatggtgtgggggctaacgca
acccataactatactgttggagaaggaactaacagtgcaacgcctctcgcttggagtcat
gcagaatacgtcaaattagtcaagtctttgacggataagaagatttgggattcctacgat
atcgttaaagcgcgatatcaaaattaa

DBGET integrated database retrieval system