KEGG   Cyanothece sp. PCC 8802: Cyan8802_3146Help
Entry
Cyan8802_3146     CDS       T00968                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cyan8802_3146
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cyan8802_3146
Enzymes [BR:cyh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Cyan8802_3146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3215790..3217115
Genome map
AA seq 441 aa AA seqDB search
MAAHLEEQQSVLEIWGQTPLKGEVTISGAKNSALALMAGSLLCSEDCRLRNLPSLADINR
MTQVLEALGVNLERNGDILDINAQDIGRSQAPYELVSQLRASFFVIGPLLARLGQTSVPL
PGGCAIGARPVDLHVRGLQAMGADVRIEHGEVHACVKGSRNRLQGAKIYLDYPSVGATET
IMMAATLAEGETIIENAAQEPEITDLADFCCSMGAKIQGAGTNTIIISGVEKLHSTDYSV
IPDRIEAGTFLIAGAITQSEISLSPVVPEHLASAIAKLQAIGPKVIIEDRDRLRVIPAPL
RATDIETLPFPGFPTDMQAQFMALLTLSEGNSVVSETVFENRLRHVAELQRMGADIRVKG
NIALVRGVPFLSGAPVMATDLRASAALVLAGLAAQGKTVVQGLHHLDRGYDNLEGKLRKL
GANLRRVDVLSEKAQELTPVN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcatctcgaagaacaacaatccgttttagaaatttggggacagacccccctt
aaaggagaagttactatcagtggggcaaaaaattcagcccttgccttaatggccggttcg
ttattgtgttctgaagactgtcgccttagaaatttaccgtctttagcagacattaaccgc
atgacccaagtgttagaagctttgggggttaaccttgaaagaaatggcgatattttagac
atcaacgctcaagacattggtagatcccaagctccctatgagctagtctcccaactgcgg
gcaagcttctttgtcattggtccattattagcccgtttaggacaaaccagcgttccctta
cctggaggctgtgccattggagctagacccgttgacctccatgtcagaggattacaagcg
atgggagcagatgttcgcatcgaacacggagaagttcatgcttgtgttaaaggtagccgt
aaccgcctacaaggagccaaaatttacttagactatcctagcgtgggagccaccgaaacg
attatgatggcagctaccctagcagaaggggaaaccatcatcgaaaacgcggcacaggaa
cccgaaatcaccgatctagctgatttttgctgttcgatgggagcgaaaatccaaggcgcg
ggaaccaataccattattatttctggggttgagaagcttcatagtacagactactctgtg
attcccgatcgcattgaagcaggaacttttctaatcgccggagccattacccaatctgaa
attagtctatctccagttgtgcccgagcatttagcctctgccattgctaaattacaagcc
attggacctaaagtgattatcgaagatcgcgatcgcctacgagttattcctgctccccta
cgcgcaactgatatcgaaaccttgccctttcctgggtttcccaccgatatgcaagcgcaa
tttatggccttgttaactctcagtgaaggcaatagtgtggtcagtgaaaccgtatttgag
aaccgtctgcgtcatgtagccgaattgcaacgaatgggtgcggatatccgcgttaaaggc
aacattgccctagttcggggagttcctttcctctctggggctcccgttatggcgacagat
ttacgcgcttctgcggccttagttttagccgggttagccgctcaaggtaagacggtagta
caaggattacaccatttagatcgcggttacgacaacttagaaggaaaactacggaaatta
ggggctaacctccgtcgggttgatgttctttcggaaaaagctcaagaattaaccccagtt
aactag

DBGET integrated database retrieval system