KEGG   Cyanothece sp. PCC 8802: Cyan8802_3549Help
Entry
Cyan8802_3549     CDS       T00968                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00010  Glycolysis / Gluconeogenesis
cyh00710  Carbon fixation in photosynthetic organisms
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01130  Biosynthesis of antibiotics
cyh01200  Carbon metabolism
cyh01230  Biosynthesis of amino acids
Module
cyh_M00002  Glycolysis, core module involving three-carbon compounds
cyh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
cyh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cyh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cyh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_3549
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan8802_3549
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Cyan8802_3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ACV02368
JGI: Cyan8802_3549
Position
complement(3614692..3615705)
Genome map
AA seq 337 aa AA seqDB search
MIRVAINGFGRIGRNFLRCWLGRENTQLELVGINDTSDPRTNAHLLRYDSMLGKLNADIS
ADENSITVNGKTIKCVSDRNPLNLPWQEWGVDLIIESTGVFVDDEGASKHIVAGAKKVLI
TAPGKGGNIGTYVVGVNDHEYDHDKYNIISNASCTTNCLAPVVKVIHENFGIIKGTMTTT
HSYTGDQRILDASHRDLRRARAAAVNIVPTSTGAAKAVALVIPEMKGKLNGIALRVPTPN
VSVVDLVAQVEKSTIAEQVNEVLKAAAEGPMKGIIEYNDLPLVSCDYRGTDSSSIVDASL
TMVMGGDMIKVIAWYDNEWGYSQRVVDLAEVVAKNWK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagtagcgatcaacggattcggacgcattggacggaactttttacggtgctgg
ttaggacgcgaaaacacccagttagagttggtggggattaatgatacttccgatccgagg
actaacgcccacctattgagatacgattcgatgttgggcaaactcaatgcggacatcagt
gctgatgaaaattccattactgttaatggaaaaaccatcaaatgtgtgtccgatcgcaac
cccttaaatttaccttggcaagaatggggagtagacctgattatcgaatctactggggtc
tttgttgacgacgagggagcttctaagcatatcgtcgctggagcgaaaaaagtgctgatt
acggctcctggtaagggaggtaacattggaacttatgtggttggggtcaacgatcacgaa
tacgaccacgacaaatacaatattattagtaatgctagttgtaccactaactgtctagct
cctgtggttaaggtgattcatgagaactttggcatcatcaaaggcaccatgaccactacc
cacagttatacaggggatcagcgcattcttgatgcgagtcaccgggatttacgtcgggct
cgtgcggctgcggttaatattgtacctacttctacgggtgctgctaaggcggttgcttta
gttatccctgaaatgaagggtaaactcaatggtattgctctgcgggttcccactcctaac
gtttctgtggtggatttagtcgctcaagttgaaaagagtaccattgctgaacaagttaat
gaagtgcttaaagctgccgcagaaggtccgatgaaaggaattattgaatacaatgattta
cctttagtttcctgtgactaccgtggaacagattcttcttctatcgttgatgctagtctg
acgatggttatgggtggcgacatgattaaggtaattgcttggtacgacaacgagtggggt
tattctcaacgggttgtggacttagctgaagtggttgctaaaaactggaaataa

DBGET integrated database retrieval system