KEGG   Cyanothece sp. PCC 8802: Cyan8802_3620Help
Entry
Cyan8802_3620     CDS       T00968                                 

Definition
(GenBank) Tetratricopeptide domain protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3693565..3696417
Genome map
AA seq 950 aa AA seqDB search
MQKKYPKLKQIFRYLSKKFYNIRALLVLILLFFISLIAPIVITQAALSYSSNPLELIQKG
QQLYQSQQFSEAVKIWQQAADLFREQGDVLNQSMSLSNVSLSYQQLGEWEEAKTAIAQSL
SLLDNQEKTTVQQGILAASLDIDGQLKLALGQPQNALETWQKAASIYQKNSHQTQVIQSL
INQAQAMQQLGFYPRACQTLLDALNINSQDCQISEEKLQLIPQENIAISLQILGLRSLGN
VLRVTGQTKQSQKVLLKSFQLAQPQKDPEILATIALSLGNTAQILGNQTPARNPQPRTIE
LRSEISCIPSQTYQTSEEFYQQAIACYRQAQIGSSSLTKIQAQLNLLSLLIQQQQGKEIP
LLINQIEDKLTVLPSSQKTILIKLKFVQQLMCLQNSFQASFNQLTPPILQSCSIVKPGLK
SHLTQEQISSWLTIQNLLETTLNQAKNIEHDPSQANVLGYLGASYQLIGNLTKAQELTEL
ALQKVSGFNYPEIAYLWQWQLGRLYQLQGENTKAIAAYRLTVDILESLRQDLVVTNTDLQ
FDFRDSVEPVYRELVAQLLQPSSNQPENPEKISQENLKKARDLIESLQLAELNNFFREAC
IEAQPQQIEQIDPHAAVIYSIVLPERLAVILSVPNQPLSYHETTLNKQFNQTSSREIEEV
FDEMFANLNPFIPSPDPLRPHQQFYNWLIRPLETELKENNIKTLVFVLDGLLRGVPMAAL
HDGKEYLIEKYRIALTPGLQLLSPRSLSQEKLKILAGGLAEARQGFSALPGVTQEVKDIS
EILPAEILLNQEFTRPRLQTEIESTSFPIVHLATHGQFSSQVEETFLLTWDERINVKNLD
QLLREREEKQQTPIEMLILSACQTATGDKRAVLGLAGVAVRSGARSTIATLWSVQDQSTA
NLMAEFYKILNQPGITKAEALRQAQLSLLHSGEYHHAFYWAPFVLVGNWL
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaaaataccctaagctcaaacaaatatttagatatttgagcaaaaaattctac
aatataagagccttgcttgtattgattttgcttttttttatctctttaatagcccctatt
gtaataacgcaagctgccctttcctattcaagcaatccacttgaattaatacaaaaagga
caacaattatatcaatcacaacaattctcagaagcagtaaaaatttggcaacaagcagcc
gatctttttcgtgaacaaggggatgtattaaaccaaagtatgtctttgagtaatgtatcc
ttaagttatcaacagttaggagaatgggaggaagcaaaaaccgcgatcgctcaaagttta
tccctcctagataatcaagaaaagacgaccgtacagcagggaattttggcagccagttta
gacattgacggacagttaaaattagcattaggacaaccccaaaatgcccttgaaacttgg
cagaaagctgctagtatttatcaaaaaaatagtcatcaaacccaagttattcaaagtcta
attaaccaagctcaagcgatgcaacagttaggattttatccaagagcttgtcagacctta
ttagacgctttaaacatcaatagtcaagactgtcaaatatccgaagaaaaactacaactt
attccccaagaaaatatagcaatttctttacaaatattgggattgcggagtctagggaat
gtcttacgagtaacgggacaaactaaacaatctcaaaaggttttattaaaaagtttccaa
ttagcccaacctcaaaaagatcctgaaatcttagccactattgccctgagtttagggaat
actgctcaaattttaggcaaccaaacccctgcgagaaatccccaaccaagaacaatagag
ttacgcagtgaaatcagttgtattccctcgcaaacctatcaaacctctgaagaattttat
caacaagcgatcgcttgctatcgtcaagctcaaataggaagtagttcgctaactaaaata
caagcacagctaaatttattaagtttattaatccaacaacagcaaggaaaagaaattcct
cttttaattaatcaaattgaagacaaactaacggtattaccatccagtcaaaaaacgatt
ttaattaaactaaaatttgtacaacaattaatgtgtcttcaaaattcttttcaggctagt
ttcaatcaactaaccccaccaattttacaatcttgttccatcgtcaaaccaggtttaaaa
agtcatctgacccaagaacagatatcctcttggttaaccatccaaaaccttctagaaaca
acccttaaccaagcaaaaaacatcgagcatgacccctctcaagcgaatgttttagggtat
ttaggtgccagctatcaactaataggaaatttaacaaaagcacaagagttaaccgaactt
gccttgcaaaaggtttctggctttaattatcctgaaatcgcctacttgtggcaatggcaa
ctagggagattgtaccaactccaaggagaaaataccaaagcgatcgcagcctataggtta
accgtggatatccttgagtcgctacgacaggacttagtggtgacgaatacagaccttcaa
tttgacttccgtgatagcgtagaaccggtctatcgggaactggtggctcaactcttgcaa
ccgtcttctaatcaaccggaaaacccagaaaaaattagtcaggaaaacctaaaaaaagcc
cgcgaccttatagaatcactacaattagctgaactcaataacttctttcgcgaagcctgt
attgaggcgcaaccacaacaaattgagcaaattgatccccacgcagccgttatctattcc
attgttttacccgaacgtctggcggtaattttatcggttccgaaccagcccttaagctac
cacgaaacaaccctcaataagcaattcaatcagacttcatcgagggaaatagaagaagtt
tttgatgagatgtttgccaacttaaacccctttattcctagtcccgacccccttcgtccc
catcaacaattttataattggctcattcgtcccttagaaacagaattaaaagaaaataac
attaaaactttagtttttgttctcgatggactgttacgaggtgtacccatggctgcccta
cacgatgggaaggagtatttaattgaaaaataccgtattgccctgactccggggttacaa
ttattaagtccgcgatcgctgtctcaagaaaagttaaaaatcctggccggtggattagca
gaagcccgtcagggtttctccgccttgcctggagtcacccaagaggttaaagacatctct
gaaattctccccgcagaaatcctcttaaatcaagaatttactcgcccgcgtctacaaacc
gaaattgagtccacgtcctttcccattgttcatctggcaacccatggtcagttttcttcc
caagttgaagagacgtttttgctgacatgggatgaacggattaatgtgaaaaacttagat
caattgttacgcgaacgggaagaaaaacagcaaactccgatcgaaatgttgattttaagt
gcttgtcagactgctactggcgacaaacgagccgtattaggattagccggggttgcagtg
cgttcaggagcccgcagtaccatcgccaccctttggtcagtccaagaccagtctacggcg
aatttgatggccgagttctataaaatcttaaatcaacccggaatcactaaagctgaggca
ctacgtcaagcacaactgtctttattgcactctggggaatatcaccatgctttctattgg
gctccctttgttttagtaggaaattggttataa

DBGET integrated database retrieval system