KEGG   Cyanothece sp. PCC 8802: Cyan8802_3625Help
Entry
Cyan8802_3625     CDS       T00968                                 

Definition
(GenBank) periplasmic solute binding protein
  KO
K09818  
manganese/iron transport system substrate-binding protein
Organism
cyh  Cyanothece sp. PCC 8802
Module
Manganese/iron transport system
Brite
Transporters [BR:cyh02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/iron transporter [MD:M00243]
    Cyan8802_3625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3698760..3699740
Genome map
AA seq 326 aa AA seqDB search
MMEKKINRGGISRFLSKLLVFGVIFGMGMTGCQSPNASTGDNDKPKVVSTSTIIANLTEE
IAKNEVDHQGILEPGADPHVYEPVPTDSVAFEEADLILYNGYNLEPGLIKLMKASGIKAK
KVAVAEVVTPLDYVYKGQKEPDPHVWGDGKNVIKMVEVIRDELIQLSPEDASIFKQNAAI
LITELERLDGWIIEQIKTIPEAQRKLVTTHDAFQYYAKAYGLEVIGTLIGISTEEQPSAQ
TVKNLTEEIKKSKVPSIFAETTINPALITTVAQEAGVKLAPNPLYADSIGTAGSEGDSYV
KMLRANTKTIVEALGGQAQVIDTPSP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaaaaaaattaatagaggaggaatatctcggtttttatctaaattgctggtt
tttggggtaattttcggtatggggatgaccgggtgtcagtcccccaatgcttcgacgggg
gataacgataaacccaaagtcgtctctaccagtaccattattgccaatttaaccgaagaa
attgccaaaaacgaggtggatcatcaagggatcttagaaccaggggctgatccccatgtt
tatgaacctgtcccgactgatagcgtggcttttgaagaagcggatctcattttgtataac
ggttataatcttgaacctgggttaattaaattgatgaaagcgtcaggaattaaagcaaaa
aaagttgctgttgctgaggttgttacgccattagattatgtctataagggacaaaaagaa
cccgatcctcatgtttggggagatgggaaaaatgtgattaaaatggtggaagtaattcgg
gatgaattaatccaattatcaccagaagatgcgtcaatttttaaacaaaatgcagcgata
ttaattaccgagttagaacgtcttgatggttggattattgaacaaattaaaaccattcct
gaagcacaacgtaagttagtaacaacccatgatgcttttcaatattatgctaaagcctat
gggttagaggtaatcgggacattaattggcattagtacggaagaacagccgagtgctcaa
acggttaaaaatttaacagaagagattaaaaaaagcaaggttccgtcgatttttgccgaa
acaacgattaatcctgctttaattaccacagttgcccaagaagcaggggttaaacttgcc
cctaaccccctgtatgcagattccattggaactgctggaagcgagggagatagttatgtt
aaaatgctgcgggctaatactaagacaattgtagaggctttaggcgggcaagctcaagtt
attgacactccctcgccgtag

DBGET integrated database retrieval system