KEGG   Cyanothece sp. PCC 8802: Cyan8802_3629Help
Entry
Cyan8802_3629     CDS       T00968                                 

Definition
(GenBank) prevent-host-death family protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3703896..3704156
Genome map
AA seq 86 aa AA seqDB search
MEKLTISDAQENLINLVKSVTQENQSYEIEMTDGSAILISQKSYESLQETIELLSIPGLR
ESLQRSLKQITNNETYSLEEVLGDID
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactcaccattagtgatgctcaagaaaacttaataaacctagttaaatcagtc
acccaagaaaaccaaagttatgaaatagagatgactgatggttcggctattttaatctca
caaaaaagctatgaaagtttacaagaaaccattgaattattgtcaattcctgggttaaga
gaaagcttacaaagatctctaaaacaaatcaccaataatgaaacctattccctagaggaa
gtattaggagacattgattaa

DBGET integrated database retrieval system