KEGG   Cyanothece sp. PCC 8802: Cyan8802_3630Help
Entry
Cyan8802_3630     CDS       T00968                                 

Definition
(GenBank) addiction module toxin, Txe/YoeB family
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3704156..3704410
Genome map
AA seq 84 aa AA seqDB search
MVYEVRFTKEAKKDIAKLTPKLKQKLKKIIEDTLSINPYSGKKLVGDLVGFFSLRLSYQD
RIIYTIDETQKLVYIHRAKTHYGE
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggtttacgaagtccgttttaccaaggaagctaaaaaagatattgctaaacttactcca
aaattaaaacaaaaactcaaaaaaattattgaagataccctgagtattaacccttatagc
ggtaaaaagcttgtcggagatcttgttggtttcttttcccttcgtttatcttatcaagat
agaattatttataccattgacgagacacaaaagctagtttatattcaccgtgcaaagacg
cattatggagaataa

DBGET integrated database retrieval system