KEGG   Cyanothece sp. PCC 8802: Cyan8802_3633Help
Entry
Cyan8802_3633     CDS       T00968                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3705768..3706565)
Genome map
AA seq 265 aa AA seqDB search
MEYFCQEINQPDDQINLAKAALYFAQEEYPTLDVEDYLNALDTMAEEVKERLPETLYPLK
IIKTINEYLFKDLKFRGNTSDYYDPDNSYLNQVIDRRTGIPITLAIIYLEIAKRLNFSMV
GIGMPGHFIIRPDFEEVGIFVDVFNQGEILFEQDCIQKLSEVYQQPMKLEPHFLEPVSHR
QILARMLTNLKYIYINAEKYPKVLRIIELLLIIFPNHPLELRDRGLLYYHLGQWQQATKD
LNLYLAMLPTAQDAHAIRELLQKIR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggaatacttttgccaagagataaaccaacctgatgaccaaatcaacttagcaaaagct
gctttatattttgctcaagaagaatatcctactctagacgtagaagactatcttaatgct
ttagatacaatggcagaagaagttaaggaacgcttgccagaaaccttatatcctctcaag
attattaagacgattaatgaatatttgtttaaggatttgaagtttagaggaaataccagt
gattattatgatcctgataatagctatctcaatcaagtgattgacagacgaacagggatt
cctattacattagctattatttatttagaaattgctaaacggcttaatttttcgatggta
ggaattggaatgccaggacattttatcattcgtcctgattttgaagaggtgggaattttt
gttgatgtttttaaccaaggggaaattttatttgaacaagactgtatccaaaaactcagc
gaagtttaccaacaaccgatgaaattagaacctcattttcttgaaccggttagtcatcgg
caaattttagccagaatgctcacaaatttaaaatatatttatattaatgctgaaaaatat
cccaaggttctgagaattattgaactgcttcttatcatctttcctaatcatcccttagaa
ctgcgcgatcgcggtttattatattatcatctgggacaatggcaacaagctaccaaggat
ctcaatttatacttagcgatgttacccacggctcaagatgctcatgccatccgtgaactt
ttgcaaaaaattcgttaa

DBGET integrated database retrieval system