KEGG   Cyanothece sp. PCC 8802: Cyan8802_3638Help
Entry
Cyan8802_3638     CDS       T00968                                 

Definition
(GenBank) HEAT domain containing protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3709712..3710899)
Genome map
AA seq 395 aa AA seqDB search
MEAARIDAAKETRVNQDLKKLVLKTQDLPGKALGTTETDHILNLALAVLHEGDFQQRWEV
AKIWTKLGKKSIAPLLTILADEEADVEIRWFVGRILGEFDDPQVIMALTNLLQVTEEEEL
SMMAASTLAKIGEGAIESLSKLLLEPSLRMTAVHSLAQIRHSQTILPLLTVIDDPNPQVR
ATVIEALGSFHDEHLVTFLLKGLKDPTARVRKEAVIALGMQHQFKKKFGLVEYLKPLLYD
HDPQVCQQAIIALGRMADNSAAEALFILLKSPATPNMMKKEVIRALSWIETPQALVYLQE
GLRWGNLKVCEEIISALGREQRPQLKTQATQILLNFIDSEQEATREPQIKQSVAMALGEL
RDPISVEVLENLTTDPDQGVRLHAIAALRKFSDVN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgctagaattgacgcggcgaaagaaacacgggtcaaccaagacttaaagaaa
ctggttttaaagacacaagatcttccagggaaagctttggggacaactgaaacagaccac
attctcaaccttgctttagcagttcttcacgaaggggattttcaacaacggtgggaagtg
gctaaaatttggacgaaactaggaaaaaaatcgatcgctcccttattaacgattctcgct
gatgaagaggctgatgtagaaattcgttggtttgtcgggcggattttgggagaatttgat
gatccccaagtcattatggctttaaccaacctccttcaagtcacggaagaagaagaattg
tctatgatggcagcttcaaccctagctaaaattggagagggtgccattgaaagcttaagc
aagttattgctcgagccgtcgttaagaatgacagcagtgcattctttagcccaaattcgt
cattctcaaacgattttacccctattaacagtgatcgatgatccgaatcctcaagtccgt
gctacggtaatagaagctttaggcagctttcatgatgagcatctcgtcacttttttgcta
aaagggttgaaagatcccactgctagggttcgtaaagaagcggtcattgccttgggaatg
caacatcaattcaagaaaaaatttgggttggtggagtaccttaaaccattactttacgat
cacgatcctcaagtttgtcaacaggcaattattgctttaggacgtatggcagataattca
gcagcagaggcattatttatcttgcttaagtcccctgctacccctaatatgatgaaaaaa
gaggtgatacgagctttaagttggatagaaacccctcaagcgttggtgtatttgcaagaa
ggactgcgttggggaaatctgaaagtttgcgaagaaattatcagtgccttgggacgagag
caaagacctcaattaaaaactcaggctacccaaattttgctcaactttattgattctgag
caagaagcaacaagagaaccccagattaaacaaagtgttgccatggctctcggagaatta
cgcgatcctatctctgttgaggttttagagaatctaacaactgatcccgatcaaggagtc
cgtcttcatgcgatcgcagcgttacgcaaattttcggacgtgaattag

DBGET integrated database retrieval system