KEGG   Cyanothece sp. PCC 8802: Cyan8802_3650Help
Entry
Cyan8802_3650     CDS       T00968                                 

Definition
(GenBank) band 7 protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3724003..3725808
Genome map
AA seq 601 aa AA seqDB search
MNPQLELNLIRKFSLKQPQTTYLEVASTEVPTPYLAQIPANSNFGWLIPAGIISGSIITV
VIVTYLMFAKFYRVCNTNEAFVISGPTRDKQVITRSTLFFPGFETITIVSLNQVTVSVVR
GHTVEKPLRTKDFLKAVFNGSLQVRVNPDQDSIRNAAMLLGTGKKGEKEILVGEEEIKKR
VNDILEGHLRDAASQANLGELQGSVETVTNHLKSKVEPDLARYGLQLLNIAITNIDELNH
YNPDNYLDIQAVVTRESIVQQNKKELEKVQEETKTEIALLKLQETQKQLAAERELRQKQL
ENTLQIEQMTAANERQVLEVRETERATQELIKVRKEQEIQEGIIISEQELQERQIQQKEA
LESAEIAKGIAINQKNQELANAEKHLIESQKEVALAATDKETAIKTAEEERQKAIARIKA
EQNKDTALIAQKGELEQQKLKAENEKVMALQLAEAIKIKAAAELDKSLKEAEGEKAKISA
QNTLSIKALTVQLAEEHLEKLIIVLPQIMAALAPQPGILGNNPIILAGTQDGENGDPTKL
LLATSGLTILTKILQNPAVMNWGQQLMKGLDSEAPLDQNGVIKFLQDNPEILHQLTNSKA
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctcaattagaactcaatttaatccgaaaattctcgcttaaacaaccccaaacc
acttatcttgaagttgcttcgactgaagtcccaaccccctatttagcgcaaattccagca
aatagtaactttggatggctgataccggccggaatcattagcggtagtatcataacagtg
gttatcgtaacttacttgatgtttgcgaaattttatcgcgtttgtaacaccaacgaagcc
tttgtcatttctggacccactcgcgataaacaagttattacccgttctaccctctttttc
ccaggatttgaaaccattaccattgtttcactcaatcaggtgacggtttcagttgttagg
ggtcataccgtggaaaaacctctacggacaaaagactttttgaaagccgtttttaatggt
agtttacaagtacgagttaacccagatcaagacagtattcgtaatgcagccatgctatta
ggaactggcaaaaaaggagaaaaagaaatcttagtcggggaagaagaaatcaaaaagcga
gtgaatgatattcttgaaggacatttgcgggatgctgcttcccaagcgaatttaggagaa
ttacaagggagtgttgaaaccgttaccaatcatctgaagtcaaaagtcgaaccagattta
gcccgttacggtctacaattactgaatattgctattaccaatattgacgaattaaatcac
tacaaccctgataactatcttgatattcaggccgtggtaacgcgagaatccattgttcaa
cagaacaaaaaagaactcgaaaaagtccaagaagaaactaaaactgaaattgctttactc
aaattacaagaaacccaaaaacaattagcagccgaacgggaattaaggcaaaaacagtta
gaaaacaccctgcaaattgaacaaatgaccgccgctaatgaacggcaagtcttagaagtt
cgagagacagaaagagcaacgcaagaattaattaaagtgagaaaagaacaggaaattcaa
gagggaataatcatctctgaacaggaattacaagagcgacaaattcaacaaaaagaagct
ttggagtcagcagaaattgctaaaggaattgccattaatcaaaaaaatcaagaattagcc
aatgctgaaaagcatctaattgaatcgcaaaaagaagttgctctcgctgctactgataaa
gaaacagccattaaaaccgccgaagaagaacgacaaaaagccattgctcgtattaaagca
gaacaaaacaaagacacagctttaattgctcaaaaaggggaattagaacaacaaaaattg
aaagcagaaaacgaaaaagttatggctttacaattagctgaagccattaaaattaaagcc
gccgccgaattggataaatccctcaaagaagcagaaggagaaaaagcaaaaatttcggct
caaaataccctatcaattaaagccttaacggtacaattagccgaggaacatctcgaaaaa
ttgattatcgttttaccccaaattatggcagcacttgctccgcaacccggaatattaggg
aataatccgattattttagcgggaactcaagacggagagaacggtgatcccactaaactt
ttattagccaccagtggactaacaatcttaacgaaaatcttacaaaatcctgcggtgatg
aattggggtcaacagttaatgaaagggttagattcagaagctcctttagatcaaaatgga
gtgatcaaatttttgcaagacaacccggaaattctacatcaattaaccaattctaaagca
gagtaa

DBGET integrated database retrieval system