KEGG   Cyanothece sp. PCC 8802: Cyan8802_3655Help
Entry
Cyan8802_3655     CDS       T00968                                 

Definition
(GenBank) UspA domain protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3729904..3730755)
Genome map
AA seq 283 aa AA seqDB search
MLDKILYADSGTGHTQEMLKVLMDLPAIKKAQLNILHVVPPQITTEAIAAKWEEGGKVIA
GILDNLSLNPSQVSTMLRQGEPKDTVCQVADEINADLIIMGSRGLKRLEAILENSVSQYV
FQLTNHAMLLVKDDIYVKKIKRIMVALDKSSAAEYALDLALYLLRDYPEGELILARVNPD
LKPELLPLPKAEMENNPVLVPAIAKAKRMGVRYRCAVTGGKPGEQICQLADEYNVDLLML
GSPDRRPSVAKGLPDLDRLLGTSLSDYVRVNANCPVLLSRKEV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgctagacaaaattttatacgcggattcaggaacgggacacactcaggaaatgctcaaa
gtcttgatggatctccctgccatcaaaaaagctcagttaaacatcctccatgttgtccct
ccccagattaccaccgaggcgatcgccgctaaatgggaagaaggaggtaaagtgatcgcg
ggtatcctagataatctttcccttaaccctagtcaagtctccaccatgttacgtcaaggt
gaacctaaagataccgtctgtcaagtcgcagacgaaatcaacgccgatttaatcatcatg
gggtcacggggactcaaacgtctcgaagcgattttagaaaattccgttagtcaatacgtc
ttccaactaactaaccacgcgatgttattggttaaagatgatatttacgtcaaaaaaatc
aaacggatcatggttgcgctcgataaatcatcagcagccgaatacgcccttgatttagcc
ttgtatttgctgcgagactatcctgaaggcgaattaattctagcacgagttaaccccgat
ttaaaaccggaattactcccgcttcctaaagctgaaatggaaaataatcccgttttagtc
cctgccattgctaaagctaagcggatgggagttcgttatcgctgtgcggttacgggaggt
aaacctggagaacaaatttgtcagttagcggatgaatataacgtagatttgttgatgcta
ggatcgcccgatcgccgtccttctgttgctaagggattacccgatcttgatcgccttttg
ggaacatctttgtccgattacgtcagggttaatgctaattgtcctgtcttattaagccgt
aaagaagtctaa

DBGET integrated database retrieval system