KEGG   Cyanothece sp. PCC 8802: Cyan8802_3661Help
Entry
Cyan8802_3661     CDS       T00968                                 

Definition
(GenBank) protein of unknown function DUF29
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3733580..3734053)
Genome map
AA seq 157 aa AA seqDB search
MIEQTLSSGQKLYDQDYQLWLETTLEQLRQGQYSQVDWENLLEEIEGMTRSDKRALKSLL
TRLFEHFLKLAYWESERDYNQGGWEREIRNFRLQIKRLLKDSPSLKPYLAEIIDECYQDS
VNLTSDNMRVSAKMFPVYPIATLEKILDEDWLPIQDQ
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacaaaccttatcatcaggacaaaaattatacgatcaagattatcaactctgg
ctagaaactaccttagaacaacttcgccagggtcagtattcccaagtagactgggagaat
ttattagaggaaattgagggaatgacgagaagtgataaacgcgctttaaaaagtttatta
actcgtttgtttgagcattttttaaaattagcgtattgggagtcagaaagagactataat
caagggggatgggaaagagagattcgcaattttcgccttcagattaaacgattattaaag
gatagtcctagcttaaagccttatttagctgaaattatagacgaatgttatcaagattct
gttaatcttacgagcgataacatgagagtttcagcaaaaatgtttcctgtgtatcctatc
gctactttagaaaaaattttagatgaagattggctgcctattcaggatcaataa

DBGET integrated database retrieval system