KEGG   Cyanothece sp. PCC 8802: Cyan8802_3664Help
Entry
Cyan8802_3664     CDS       T00968                                 

Definition
(GenBank) Ion transport 2 domain protein
  KO
K10716  
voltage-gated potassium channel
Organism
cyh  Cyanothece sp. PCC 8802
Brite
Transporters [BR:cyh02000]
 Other Transporters
  Pores ion channels [TC:1]
   Cyan8802_3664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3735984..3736799)
Genome map
AA seq 271 aa AA seqDB search
MVDQPITLKKKLSHYLDDFDSLTGIIINLIILGLILLSFLIFVVETYPISESLLIRLKQL
DKIILLVFTLEYIIRFWCSDNKLRFLFSFFSWIDLLAIVPLFVGFLDIRYILIIRWFRIL
RLIRLIELATFLLKIKTEDGVILTRIFLSLLSLVFIYSGAIYQIEHQTNPQIFQNFFDAL
YFSIVTMTTVGFGDVTPLSETGKFITLMMILSGIILIPWQISILTQQLLKITNKSPKLCF
HCGLTVHEHDANFCKICGAKLENNEQIISQR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggtagatcaacccataacactcaagaaaaaactgagtcattatttagacgactttgac
agccttacaggaattattattaatttaataattctagggcttattttactatcttttcta
atctttgttgttgaaacttatcctatttcagaatctttattaattcgcttaaaacaacta
gacaagatcattcttttagtttttactttagaatatattattcgtttttggtgttctgat
aataaattaagatttttatttagttttttttcttggattgatttactcgccattgttcct
ctatttgttggatttctagatattcgttacattctcattatccgttggttcagaatactg
agattaattcgattgattgaattagctacttttctcttaaaaataaaaactgaagacggc
gtaattttaactcgaatatttttgagtttattatcgctagttttcatttactctggtgct
atttatcaaattgaacatcaaactaacccgcagatttttcaaaatttttttgatgcgtta
tatttttcaattgttaccatgacaaccgttggttttggcgatgttacacctctttcagaa
acgggaaaatttatcacgttaatgatgattctttcaggaattattttaattccttggcaa
attagtatcctaactcaacaacttctcaaaattaccaataaatctcctaagctttgtttt
cattgtggactaactgttcatgaacatgatgctaatttttgtaaaatttgtggtgcaaag
ctagaaaataacgagcaaattattagtcagagatag

DBGET integrated database retrieval system