KEGG   Cyanothece sp. PCC 8802: Cyan8802_3666Help
Entry
Cyan8802_3666     CDS       T00968                                 

Definition
(GenBank) Alpha-mannosidase
  KO
K01191  
alpha-mannosidase [EC:3.2.1.24]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cyan8802_3666
Enzymes [BR:cyh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     Cyan8802_3666
Membrane trafficking [BR:cyh04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    Cyan8802_3666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3737700..3740804
Genome map
AA seq 1034 aa AA seqDB search
MILETIDQLRQLTQTDIQTGWVHTDDEIDFKSINLDAWEKGELNEKGYIIWSAGKKVKWL
GQKFIIPEHLSGYPLGGLTLRLALTWWAEDAKIFVNNHLVQEGDLFDSSSRILLTSSVQP
GEEILVLLRLVSPGHDIGGLMKSKLIYERESNSTVDDDFNKLVIDPGFVADELTILYNYL
SAFDPKKLEILNQFINQINWKLVSDASKFDRCLLDLREKILPLANYIKQSSLNLLGHAHL
DMAWLWPVNETWDAAKRTFTSVINLQKEFPSLIFGHTSPVLYEWIENHRPDLFDEIIQAF
KAGKWELLGGMWVEPDVNLVSGESLVRQLLYGQKYFNNKFGEISQVAWLPDSFGFCWQLP
QILQQSGINYFVTGKLHWNATVKFSQGFFKWESPDGTQILTLISPPNVAGVMDTNPILMT
NYAMDWEKQTGLKEAFWLPGVGDHGGGPTRDMLAIQKRWEKSPFFPQSQFTKAIDYLNKI
SQATQEIPIWKDELYLDFHRGCYTTHADQKWFNRRSEDLLYKAELWSSIATILLEKTNNC
ASKKLLEEAWKKVLFNQFHDILPGTSITEVFVQANEEWQQVQATGQNILNESLEAIASQI
SLPQPPQADSIPLVVFNSLNWERSQVVECSKVAENCQVYNLEGHLLTSQLSSENNLLFLA
ENIPSIGYRVFWLCPGKNSVNNVVLSYPQDYILENEYLKVIIDNKTGDIDSIFDKVNQKE
VIKGKANQLQTFQDQGQYWDAWNIDPNYNNYPLEETELKSIEYLEIGPIQWKIRVIRQFR
KSEFCQEYILQIHSKILKIQTQVNWQETHVLIKASFPLAIANNNTTYEIPFAAIERNNNP
ETPEEKAKWEVPALRWADISDPSQDYGVSLLNDCKYGYDSQSDRLRLTLLRSPLWPDPKC
DRGLHHFTYAIYPHQGNWKEAKTVQQGYELNIPLDLVYLPQVSTKSSHKLPSINYFLKFK
SDNLILSAFKPSEDNASYWILRCYESEGKISQMCLENNLNLQLTDSVNLLEEPLAEFSQV
DPWKIVSFQGTIIK
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atgattcttgaaacgattgatcaattaagacaactcactcaaacagatatccaaacaggt
tgggttcatactgatgacgaaattgattttaagtcaatcaatcttgatgcttgggaaaag
ggggaacttaatgagaaaggatacattatttggtcagcaggaaaaaaagttaaatggtta
ggtcaaaaattcattattcctgaacatttaagcggttatcctttagggggactgacttta
agattagccttaacttggtgggctgaagatgctaaaatttttgttaataatcacttagtc
caagagggagatttatttgattcttcctctagaattttattaacctcatcagtacaacca
ggagaagagattttagttcttttacgcttagttagtcctggtcatgatattgggggatta
atgaagtctaaactgatttatgagagagagagtaactcaactgttgatgatgattttaat
aagttagttattgatccgggttttgtcgcagatgaattaacgattttatataattattta
agtgcttttgatcctaaaaaactagaaatacttaatcaatttattaatcaaattaattgg
aaattagtatctgatgcaagcaagtttgatcgatgtttacttgatctgcgtgaaaagatt
ttacccttagcgaattatatcaaacaaagctctctaaatttactaggtcatgcccattta
gatatggcttggttgtggccagttaatgaaacttgggatgctgcaaaacggacatttacc
tcagttattaacttacaaaaagagtttcctagcctaatatttggtcacaccagtcctgtt
ctttatgaatggatagaaaaccatcgtcctgacctttttgatgagattatacaagctttt
aaagcagggaaatgggaacttttaggagggatgtgggttgaacccgatgtgaatttagtt
tccggtgagtctttagttagacaactgctgtatggacagaaatattttaacaataaattc
ggagaaattagtcaagttgcttggcttcctgatagctttggtttttgttggcaattaccg
caaattttacaacaaagtggcattaactattttgttacggggaaacttcattggaatgca
acggttaaattttctcaaggattttttaaatgggaatctcctgatggaactcaaatatta
accttaatttctcctcctaatgtagctggagtaatggatactaaccccattctcatgacc
aattatgctatggattgggaaaaacaaacggggttaaaagaggctttttggttgcctgga
gttggcgatcatggaggaggtcctacccgtgatatgttagccatacaaaagcggtgggaa
aaatctccattttttcctcaatcacagtttactaaagcgatagactatttaaacaaaatt
agccaagcaacgcaagagatacctatttggaaagatgaactttatctcgattttcatcga
ggctgttatacaacccatgctgatcaaaaatggtttaatcgtcgtagcgaagacttatta
tataaagcagaattatggtcatcaatagcaacaattcttttagaaaaaactaataattgt
gcgagtaaaaaattattagaagaagcttggaaaaaagttttgtttaatcaatttcatgat
atcttaccgggaacttctattacagaagtctttgttcaagcgaacgaagagtggcaacaa
gttcaagcgacaggtcaaaatatcttaaatgagtctttagaagcgatcgcgtctcaaatt
agtctaccacaaccccctcaagctgatagtatccctttagtcgtttttaactctttaaat
tgggagcgatcgcaagttgtagaatgttctaaagtagccgaaaattgccaagtttataat
ctagaaggacatctattaacttctcagttatcctcagaaaataacctactatttttagct
gaaaatattccctcaattggttatcgagtcttttggttatgtcctgggaaaaattcagtt
aacaatgttgttctatcttatcctcaagactatattttagaaaacgaatatttaaaagtg
attattgataataaaacgggagatatagacagtatttttgataaagtaaatcaaaaagaa
gttattaaaggaaaagctaatcaacttcaaacatttcaagatcaaggacaatattgggat
gcttggaatatcgatccgaattataataattatcctttagaggaaactgaattaaaatca
attgaatatttagaaatagggcctattcaatggaaaataagggtaattagacaattcaga
aaatcagaattttgtcaagagtatattttacaaattcattcaaaaatcttaaaaattcaa
acccaagttaattggcaagaaacccatgtattaattaaagcatcctttcctttagcaata
gcaaataacaatacaacctatgaaattccttttgctgctattgaacgaaataataacccc
gaaactccagaagaaaaggctaaatgggaagttcctgctttaagatgggcagatattagt
gacccatctcaagattatggtgtaagcttattaaatgactgtaaatacggctatgatagt
caaagcgatcgcctgagactcacactattaagaagtcctctgtggcctgatcctaaatgc
gatcgcgggttacatcattttacctatgctatttacccccatcaaggcaattggaaagaa
gcgaaaacagtccaacaaggatacgaattaaacatcccgttagatctcgtttatttgcca
caagtttcgacaaaatctagtcataaattaccctcaattaattacttcttaaagttcaag
tcagataatttaattttatccgcttttaaaccgagtgaagataacgctagctactggatc
ttacgctgttatgaatctgaggggaaaatttctcaaatgtgcctagaaaataacctaaac
ttacagctaactgactcagtcaaccttttagaagaacctcttgctgaattttcccaagtt
gacccctggaaaattgtcagctttcaaggtacaataattaagtaa

DBGET integrated database retrieval system