KEGG   Cyanothece sp. PCC 8802: Cyan8802_3667Help
Entry
Cyan8802_3667     CDS       T00968                                 

Definition
(GenBank) hypothetical protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3740827..3742281
Genome map
AA seq 484 aa AA seqDB search
MQNIKMVLNRLPINQEQWNQKNFDILLIILGIILPFILVTFLDSYSRYDVGVFEDWASCW
GQEIYLECPTTLVYPSGALIFSAGVIQGIKSLLSINDRHTVASVFRYFLAFFDSLNFLLW
IYLAKMIHLRLAIVFAFIVLIIPSSWAGSSVWGQIEGISLFFCLASTIFFLKSWTKKQTN
SHNKKAWKSGVWLLLGTPLLSIFILTKQWNIFSLPFFLLVFVVTVVQFWTNFGYRCIFWV
LSALILLTLSFLYLDSFFLVVREFHHSSYWLIWTGPASNLIKKIAGNGFNIWIFLGRPRG
SSSLVPFLTFNIGNWKSSLTPFKTGLFLYSMFIIFLLFTFYRNVLRVLQQNIMNKNLYQL
NDYVIAILLFFHGLCHLGFNVLLSGTHERYLYLGYPSLLMAVIWFYTNKIVFSWHSTLLC
FLAAFAYGCFVYSRIGNLPKFLILLQKHEFLGGIHFLLLGFLFYLWLQVCKNYKKTLHIS
PNLD
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatattaagatggtattaaatcgtttacccattaatcaagaacaatggaaccaa
aaaaattttgatattcttttaattattttaggaatcattttaccgtttattttagtaaca
tttttagattcatatagtcgttatgatgtaggagtctttgaagattgggcaagttgttgg
ggtcaggaaatttatttagaatgtcctactacgttagtttatccctctggtgcactaata
tttagtgcgggagtcatccagggaatcaaatctcttttgtcaattaatgatcggcatact
gtagcatcagtttttcgctattttcttgctttttttgatagtttaaattttctgttatgg
atttatcttgccaaaatgatccatcttcgcttagcaattgtttttgccttcatagtcctt
attataccatctagttgggcaggcagttctgtgtggggtcaaattgagggtatttcctta
tttttttgcttagcttctactatattttttctaaaatcatggacaaaaaaacaaactaat
agccacaataaaaaagcttggaaaagcggagtttggttacttttaggaactccactctta
tcaatctttattttaacaaagcagtggaatattttttcattacctttctttttgctagtt
tttgtggtaacagtagtacaattctggactaattttggttatcgatgtattttttgggtg
ctttcagccttaattttattgacattgtctttcctttatttggatagttttttcctagta
gtcagggaatttcatcattcaagctattggttgatttggacaggcccagctagcaacttg
atcaaaaaaattgctggtaatggatttaatatttggatctttcttggacgacctagagga
agttcttctctcgttccatttttgacttttaatattggcaattggaaaagttctctaact
ccttttaaaacaggattgtttttatattcaatgtttataatttttctattgtttacattt
taccgaaatgttttacgggttttgcaacaaaatattatgaacaaaaatctatatcaatta
aatgattatgttatagctatattattgttctttcacggtctttgccatcttgggtttaat
gttttgttaagtggaacccatgaacgttacctatatttaggatatccgtctttgctaatg
gcagtgatttggttttacactaataagatagtattctcatggcattcaacgttattatgt
ttcttagcagcttttgcctatggatgctttgtttattcaagaattgggaatttgccaaaa
tttcttattttattgcaaaaacatgaatttttaggaggtattcattttttacttttaggt
tttcttttttatctctggctacaggtttgtaaaaattacaaaaagacattacatatttcg
ccaaatttggattaa

DBGET integrated database retrieval system