KEGG   Cyanothece sp. PCC 8802: Cyan8802_3673Help
Entry
Cyan8802_3673     CDS       T00968                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoxygenase TTR-52
Motif
Other DBs
NCBI-ProteinID: ACV02485
JGI: Cyan8802_3673
Position
complement(3748182..3750188)
Genome map
AA seq 668 aa AA seqDB search
MSTKTKTIFDEIKAALVLKVIDSPLGRKLIEEKAEKQVSKTQEAITKPIEQLSKATGQLL
FSDTNKPLHNIELEVWDRDVGTPSDYLGKGVTDQNGRFEIYYDPEKAGFKDAPDLELRVI
DNRVTFDSDNQPVYTNRIAYIIKGGDNVTQKTYDFGTLTVPYWPYDPNSPFARIFMPNPE
ETPDDYSVGRKFQAYASANVLTPIKAKHTIAHTLNPKEPSLTQIQADYPPNLTINLDREK
PGYTRSDEYFVLRVLNGMNPCLLKRSKSDPNQFKMSFIWDNYEKDTEHDLHNVEAYFILK
DGKLFPTMITIQSRYPDSLAPHSPLKDREVYTPNDGEKWLQAKRIFRTAALFDGEAIEHY
AKAHVQMEQYAVACFRNLRKNPIRLMLTPHLKSIININRRGDDLLVEPNLGLFVTNGPLT
YPGFLQMCTEVVATYDWKDWQPRQPICDDHKYAKAANLYWQILTEYVDAFFAKHQQAIAD
EWVEIRRFSEDLVEHSMPYQPIEGIMANTDSDYEWYDTGELDKPDLPRAMFNGKTKVIRP
ITNSNQPSATDIDNLKQCCRHIIFHTTLWHTWVNDSQSDEGGELAYNSLALRNGSFGSET
DPNIAPDPIEATNQVYIFSVLNGIKYGLLVKNEDDDVPEELRTALLNRKDQFAELGIDIG
NIRTLINI
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccaaaacaaagacaattttcgatgaaataaaagctgctttggtattgaaagtc
atcgatagccctttgggacggaaattaatcgaagaaaaagcggagaaacaagtctctaaa
acccaagaggctatcaccaaacctatcgaacagttaagtaaagcaacgggtcaattactc
tttagtgataccaataagcctttacataacatcgaattagaggtgtgggacagagatgtc
gggacaccaagtgattatttagggaagggagtaacggatcaaaatggtcgctttgaaatt
tactacgatcctgaaaaagccgggtttaaagatgcaccggatttagaattacgggtcatc
gataatcgtgttacctttgatagcgacaatcaacctgtttatactaatcgcatcgcctat
attatcaaaggtggggacaatgtaacccaaaaaacctatgatttcgggacgttaacggtt
ccttactggccttacgatcctaacagtccctttgcgcggatcttcatgccaaatcctgaa
gaaacccccgatgattactccgtaggacgcaaatttcaagcctatgcctcggctaatgtt
ctcacccccattaaagccaagcatactatcgctcatactctaaacccgaaagaacctagt
ttgacccaaattcaagcggattatccccccaatttaaccatcaatttagatcgggaaaaa
cccggatatactcgtagtgatgaatattttgttttgcgggttctcaatggcatgaatcct
tgtttgctcaagcgcagtaaaagcgatcccaatcagtttaagatgagcttcatttgggat
aattacgaaaaagatacggaacacgatcttcataatgttgaggcctattttatattaaaa
gatggcaaacttttcccaacaatgatcaccattcaaagtcgctatcctgattctttggct
ccccattctcctctgaaagatcgggaagtgtatactcccaatgatggggaaaaatggtta
caagctaaacggattttccggacggctgctttatttgacggagaagcgatcgagcattat
gctaaggctcatgtgcagatggaacagtatgcggtagcttgtttccgtaatctacgcaaa
aaccccatccgtttgatgttaactccccatttaaagagcattattaatattaatcgccgt
ggggatgatttactggtagaaccgaaccttggcttatttgtgactaacggtccgttaacc
tatccagggttcttgcaaatgtgtacggaagtagtggcaacctacgactggaaagactgg
caaccccgtcaacctatctgcgacgatcataagtacgctaaggcagcgaatctctactgg
cagattttaaccgaatatgttgacgcattttttgcgaagcatcaacaagcgatcgcggat
gaatgggtagaaattcgccgtttttctgaggatttagtcgaacatagtatgccctatcaa
cccattgagggcattatggcgaataccgatagtgattacgaatggtatgatacaggggaa
ttggataagcctgatcttcccagagcgatgtttaatggcaagactaaggtaattcgaccg
attactaactctaatcaaccaagtgccacggatatcgacaatttaaaacaatgttgccgt
catatcatcttccatacgactttatggcacacttgggttaacgattctcagtccgatgag
gggggagaattggcttataattccctagcgttacgcaatggtagttttggtagtgaaact
gatcctaacatcgcccctgatcccatagaagcaaccaatcaggtttatatcttcagtgtc
ttaaatggcattaagtacggcttgttggtgaaaaatgaggatgatgatgtgcctgaagag
ttaagaacggctttgctcaatcgcaaggatcaatttgctgaattaggcatcgatattggc
aatattcgcactttaattaatatttag

DBGET integrated database retrieval system