KEGG   Cyanothece sp. PCC 8802: Cyan8802_3679Help
Entry
Cyan8802_3679     CDS       T00968                                 

Definition
(GenBank) hypothetical protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3758092..3758301)
Genome map
AA seq 69 aa AA seqDB search
MTIWVNEQIDPCGIIYSCIACSDETAARECHQTWLNNLSDQQKQDGWTAILRTVNSWDEV
PVNALKLSV
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttgggtgaacgaacaaatcgatccctgtggcattatttattcttgtattgct
tgctccgacgaaacggctgcgcgtgaatgccatcaaacttggttaaataacctaagtgat
caacaaaaacaagacggttggacagccattctcagaaccgtcaactcttgggatgaagtc
cccgttaatgcgcttaaattgagtgtttag

DBGET integrated database retrieval system