KEGG   Cyanothece sp. PCC 8802: Cyan8802_3680Help
Entry
Cyan8802_3680     CDS       T00968                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 HTH_11 HTH_24 HTH_40 Sigma70_ECF
Motif
Other DBs
NCBI-ProteinID: ACV02492
JGI: Cyan8802_3680
Position
complement(3758333..3759004)
Genome map
AA seq 223 aa AA seqDB search
MPLLILIADDDPGIRLAVKDYLELSGYSVITAQNGQEALSLLETYRPHLLVSDIKMPQKD
GYTLVRHLRQLPEFRLLPVVFLTERGTKEERIQGYEVGCDVYLPKPFEMDELKAVIRNLV
EKTQIIQSEWRFSQGESQPKPTLEPSQKEAIAVPSLLNSLHLTSRESQVLNLLARGLSNG
EIGQNLHLSSRTVEKYVSSLLRKTETNNRAELVRFALDHHLID
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgccattattgattctcattgctgatgatgatccagggattcgtttagctgttaaagat
tacctggaattgtcgggttattccgtaataaccgcccaaaatggacaagaagccctatct
ttgctagaaacctatcgtccgcacctcttggtatccgatatcaaaatgccacaaaaagat
ggctacactctagtgcgtcatctgcgtcagcttcctgaatttcgcctccttccagtggta
ttcttgacggaacgggggactaaagaagaacgcatccaaggatatgaagtaggatgcgat
gtctatctccctaaaccctttgaaatggatgaactcaaagcagtcatccgtaatttagtc
gaaaaaacccaaatcattcagtcagaatggcgattttctcaaggggaaagtcaacctaaa
ccgacattagagccttctcaaaaagaagcgatcgccgttccttccctgcttaattctcta
catcttacctcacgggaaagtcaagtcctcaatttattagctagagggctgtctaacgga
gaaattggacaaaatctgcatttaagttcccgaaccgtggaaaaatatgtcagtagccta
ctgaggaaaaccgaaacgaacaaccgagccgaattagtgcgttttgccttagatcatcat
ttaatagattga

DBGET integrated database retrieval system