KEGG   Cyanothece sp. PCC 8802: Cyan8802_3681Help
Entry
Cyan8802_3681     CDS       T00968                                 

Definition
(GenBank) hypothetical protein
  KO
K03666  
host factor-I protein
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Quorum sensing
RNA degradation
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cyan8802_3681
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cyan8802_3681
Messenger RNA biogenesis [BR:cyh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     Cyan8802_3681
Chromosome [BR:cyh03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Cyan8802_3681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3759072..3759284)
Genome map
AA seq 70 aa AA seqDB search
MAEFNTGLPSVRLVQQWIKDKKEVDVKLITNDLLVGIILWQDPQCIYLSEVSGQSTLIWR
DSLVYLKPKG
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatttaatacagggctaccgagtgtccgtcttgttcaacagtggatcaaagac
aagaaagaagtagacgttaagctaatcactaatgacctcttagtgggaataattttgtgg
caagatccccaatgtatttacttaagtgaggtttctggacaatcaaccctaatttggcga
gatagcctagtttaccttaagccaaaaggataa

DBGET integrated database retrieval system