KEGG   Cyanothece sp. PCC 8802: Cyan8802_3687Help
Entry
Cyan8802_3687     CDS       T00968                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K08884  
serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
cyh  Cyanothece sp. PCC 8802
Brite
Enzymes [BR:cyh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Cyan8802_3687
Protein kinases [BR:cyh01001]
 Serine/threonine protein kinases: Other group
  Bacterial family
   Cyan8802_3687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3765283..3766533
Genome map
AA seq 416 aa AA seqDB search
MNLFDRYKIEKTLGHGGFGETFLAKDTRMPSQRLVVIKKLKPINQLNVDDQIIKDSFRKE
AAVLEKLGESHPNIPKLYEYFEYESEFYIIQEYIEGKTLAEISPVSSEKAFSILCSILET
LQYVHDNKIIHRDIKPENIIIRDADQQPILIDFGAVKDSMGKVKLNSGSTVGSKIIGTRG
YMAPEQSQGYPIFSSDLYSLGRTMIFALTGKIPIADEIEINPLTGELEWTKYVSEIDDKL
AYVINKANQLSPNLRYPTAKEMRQDLMLNSQIKTKVLNLNSQKKSANNSQEIPDITILSS
KPHNKNIKTSFSFVFPQSPDNIWKLLIAGGASCTIVAISIFTGFQWAIKNNTENLIAESE
TYYQNQKHEDCFNTVKKAINESKQLFIFDKNNLFNRAIDLENKCQVAYAKKLLANA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaatctatttgatcgctataaaattgagaagacattaggtcatggtggattcggagaa
acttttcttgcaaaagataccagaatgccatctcaacgactggttgtgattaaaaagctt
aaaccgatcaatcaattaaatgttgatgatcaaattataaaagatagctttagaaaagaa
gcggctgttttagaaaaattgggcgaaagtcatcctaatattcctaaactttatgaatac
tttgaatacgaatcagaattttatattattcaagaatatattgaaggaaaaaccttggct
gagattagtcctgtttcgtcagagaaagctttttcaattttatgttcaattttagaaact
ttgcagtatgttcatgataataagattattcatagagatatcaaacctgaaaatattatt
attcgggatgctgatcaacaacctattttaattgattttggtgcagttaaggattcaatg
ggaaaggtgaaattaaattccggttctactgttgggtctaagattataggcacacgagga
tatatggcaccagaacaaagtcaaggttatccaatttttagtagtgacttatattcatta
ggtcgaacgatgatttttgcgcttacaggtaaaattcctattgcagatgagattgaaata
aatcctttgaccggagaattagaatggacaaagtatgtatcagagattgatgataaatta
gcttatgttatcaataaagcaaatcaactttctccaaatcttcgctatccaacagcaaaa
gaaatgagacaagatttaatgctaaattcacaaataaagacaaaagttctcaatttaaat
tctcaaaaaaaatctgcaaataactcccaagaaataccggacattacaattcttagttca
aagcctcacaacaaaaatattaaaacttctttttcttttgtcttccctcaatcacctgat
aacatctggaaattattgattgctggtggtgctagttgtactatagtcgccattagtata
tttacaggttttcagtgggctattaaaaataacacagagaatttaatagcagaatctgaa
acttattatcaaaatcaaaaacatgaagattgttttaatacagtaaaaaaagcaataaat
gaatcaaagcaattgtttatttttgacaaaaacaacttatttaatagagcaattgattta
gaaaataagtgtcaagtagcttatgctaaaaaattattagcaaatgcctaa

DBGET integrated database retrieval system