KEGG   Cyanothece sp. PCC 8802: Cyan8802_3689Help
Entry
Cyan8802_3689     CDS       T00968                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K03856  
3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan8802_3689
Enzymes [BR:cyh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Cyan8802_3689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3767813..3768664
Genome map
AA seq 283 aa AA seqDB search
MFNAQLALKSNPEAITLVSLTDTVVFGGQDIVMIGGPCAVESLAQMEAVANGLSLAPVQA
LRGGAFKPRTSPHSFQGLGLEGLKILAEVKRRYGIPVVTEVMSTEQIEAVATYADMLQVG
SRNMQNFELLKALGHVNKPILLKRGLAATLEEFIGAAEYILSHGNTQVVLCERGIRSFDN
YTRNVLDLGAVVALKQLTCLPVIVDPSHAAGRRELIAPLAKAAIAAGADGLIIECHPQPE
KSVSDAAQALSLEEMVSLVHSLQPIAQAIGRSIVPFSRSLIAA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacgctcaactcgccctaaaatccaatcctgaagccattacccttgtttcttta
acggatactgtcgttttcggcggtcaagatatcgtaatgattggtggcccctgtgcggtg
gaaagtttggcacaaatggaagccgtcgctaatggcctaagtttagcaccagttcaagcc
ttgcggggaggagcttttaaaccaagaacctccccgcattctttccaaggactcggccta
gaagggttgaaaattcttgcagaggttaaacggcgttacggtattcccgtggtaacagaa
gtgatgtctactgagcaaatagaagcagtagcaacctacgctgatatgttacaggttggt
agccgaaatatgcaaaattttgagttactcaaagcattaggccacgtcaataaacccatc
ctcctcaaacggggtttagcggctacccttgaagagtttattggtgcagcagaatacatt
ttgagccatggtaacacacaggtagtcctctgtgagcgaggaatccgcagttttgataac
tacactcgcaatgtgctagatttaggggcagttgtcgctctaaaacagcttacctgttta
cccgtgattgttgatccctcccacgcagccggtagacgggaattaattgcgcctttagct
aaggcagcgatcgcggccggggctgatggattaattatagaatgccatcctcagcccgaa
aaatcggtttctgacgcagcacaagccctttctttagaagaaatggtcagtttagtccat
agcttacaacctatcgctcaagctattggccgttctattgtaccgttttctcgttcacta
attgcagcttga

DBGET integrated database retrieval system