KEGG   Cyanothece sp. PCC 8802: Cyan8802_3693Help
Entry
Cyan8802_3693     CDS       T00968                                 

Definition
(GenBank) uncharacterized metal-binding protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3771519..3772079
Genome map
AA seq 186 aa AA seqDB search
MPSGRTHDRITFWGLPPLMGLTYLLSGKIDLTLILVGSYLFSGLMFGPDLDIHSVQYNRW
GIIRGIWLPYRFLLKHRSFFSHGFVIGTLLRLLYLGSILTLVAILGVAIAQLIWGFDWNW
QQFTHRLIELIMTEYLQEAIAFTIGLELGAMSHAISDYLDSAWKRYQKKKPTSNHRKRKT
PRRSRK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctggtcgcacccacgatcgcatcactttctggggtttaccccctctgatggga
ctcacttacctccttagcgggaagatagaccttaccttgattctcgtagggtcctatcta
tttagcgggttgatgtttggaccggatctcgatatccactcggtacaatataaccgatgg
ggaattatccgtggaatttggcttccctatcggtttttgctgaaacatcgctcttttttc
tcccatggctttgttattggaactctcttgcgtctgttgtatcttgggagtattcttacc
ctagtcgctattttgggagtagcgatcgcccaattgatctgggggtttgattggaattgg
cagcaattcacccataggctaatagagttaatcatgactgaatatctccaagaagcgatc
gctttcaccattgggttagaattaggagcaatgagtcatgctattagcgattatctggat
tccgcttggaaacggtatcagaaaaaaaaaccaactagcaaccaccgcaagagaaaaacc
ccccgaagaagtcgcaagtaa

DBGET integrated database retrieval system