KEGG   Cyanothece sp. PCC 8802: Cyan8802_3701Help
Entry
Cyan8802_3701     CDS       T00968                                 

Definition
(GenBank) Lytic transglycosylase catalytic
  KO
K08309  
soluble lytic murein transglycosylase [EC:4.2.2.-]
Organism
cyh  Cyanothece sp. PCC 8802
Brite
Enzymes [BR:cyh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.-  
     Cyan8802_3701
Peptidoglycan biosynthesis and degradation proteins [BR:cyh01011]
 Peptidoglycan biosynthesis and degradation
  Lytic transglycosylase
   Cyan8802_3701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3777682..3779874)
Genome map
AA seq 730 aa AA seqDB search
MLKPLKNKSSLLVGSGLLGLALIGTIPLAPKAIDWMEQRQQAQIEKALQEDGNKPSVVLT
LAEIPSEQRRQKLEEIAASDTLSLERSRARYLLAVDLLKKYEGGPALRQLEGLEKEYPVL
APLILLKRGRGYELTNEKAKAQETWQELVKTYPDSLIAAEALVKLGQSDSSHWDEAIAKF
PQHPGTQEIIRERLKKNPQQPELLLLLAKYDKNNPATNPMRDRLVKDYASQLTPEDWQAI
ADGYWAVEDYYKAALAYQKAPSTAQNLYRIGRGQQLQPNGNNKATVQAAYQKLLVAFPQA
PEAALALQRLAQLSQPETAISYLDQLINKFPEQAGYALVKKAELLDKLNRQGEATKIRQT
LLSKYAKSDATAEYRWLIAQKAAERGDALKAWTWAQPIVVNNPESPLAPKAGFWVGKWAQ
QLGRLEEAETAFEYVVTRHPQSYYAWRSAVQLGWNVGNFNTIRQTLPQVAKPTTRSLPPA
GSAMFQELYRLGQDREAITLFQAEMSDRAELDVNESFTDALLKLVQGKNLVGINQVWDLK
KKEELESQEQWQKLRETPEYWHALFPFPFYQTIMDWSQKRQLNPLLVTSLIRQESRFEPE
IASPVGAKGLMQVMPATGEWVANKIQLKNYSLSNPNDNVNLGTWYLNHTHDTYSNNSLLA
VASYNAGPGNVSKWVKRYQTSDPDVFVEKIPFKETKGYVESVFGNYWNYLRIYNPDIAQL
LAQKNQQTPK
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagccactcaaaaacaaaagctctctcctagtcggttcaggactgctaggactc
gcattgattgggacaattccccttgctcccaaagcgatagactggatggagcaaaggcaa
caagctcaaattgaaaaggcattgcaagaagacggcaataaaccctcggtggtgctaact
ttagcggaaattccctcagaacaaagacggcaaaaactcgaagagatagctgcctctgat
accctatctttagaacggagtcgtgctcgctatttattagcagtggatttgctcaaaaaa
tacgagggaggccccgctttacgacaacttgaagggctagaaaaggaatatcctgtatta
gcccctctgattcttctcaaaaggggtcgaggctatgaattaaccaatgaaaaagctaaa
gctcaagaaacttggcaagaattggtgaaaacctatcctgattccttaattgcggctgaa
gctttagttaaactaggacaatctgattctagtcattgggatgaagcgatcgctaaattt
cctcaacatccgggcactcaagaaattattagggaacgtcttaaaaaaaatccacaacag
cctgagttattgctgttgttggcaaagtatgacaaaaataaccctgctaccaatccaatg
cgcgatcgcttggttaaagattacgccagtcagttaacgcctgaagattggcaagcgatc
gcggacggttattgggcagtagaagattattataaagccgccctagcctatcaaaaagct
cctagtacggcacaaaacctttaccgcatcggcagagggcaacagcttcaacccaacggc
aacaataaagctacggtgcaagcagcctatcaaaaactattggtagcctttccccaagca
ccagaagcggctttagccttgcagcgactcgcccaattatctcaaccggaaactgccatt
agctacctcgatcaactgatcaataaattccctgagcaagcggggtatgcgctggtgaaa
aaggctgaattacttgataaattgaaccgacaaggggaagcaacgaaaattcgccaaact
ttattgtctaaatatgctaaatccgatgcgacggctgaatatcgttggttgattgctcaa
aaagcggctgaacggggagatgctctaaaagcttggacgtgggcacaaccgattgttgtt
aataacccagagagtcctttagccccgaaagcagggttttgggtggggaaatgggcgcaa
cagctaggacgactcgaagaagcagaaacagcttttgagtatgtggtgactcgtcatccc
caatcttattatgcttggcgatcggcagtacaattaggctggaatgtagggaattttaat
acgatccgtcaaaccttaccccaagtggcgaaaccgactacccgttcgctaccaccggcc
ggttcagctatgtttcaggaactgtatcgtttaggacaagatagggaagcaattacatta
tttcaagctgaaatgagcgatcgcgctgaacttgatgttaatgagtcctttaccgatgcg
ttattgaaattggtacaaggaaaaaatctggtgggaattaatcaagtttgggatctcaag
aaaaaagaagaacttgagtcacaagaacagtggcaaaaactcagagaaacgcccgaatat
tggcacgctttattcccgtttcctttctatcaaacgatcatggattggtcacaaaaacga
caattaaatcctttattagttacgtctttgattcgtcaagaatcgcgttttgaaccagaa
attgcttctccagtgggtgctaagggattaatgcaggtgatgccagcaactggggagtgg
gtagctaacaaaattcaactgaaaaattattctttaagtaatcctaatgataatgtgaat
ttgggaacgtggtatttgaatcatacccatgatacctacagtaataattctttattagcg
gttgctagttataatgccggtccaggaaatgtatctaaatgggttaaacgatatcaaacg
agtgatcctgatgtttttgttgagaaaatcccttttaaagaaacgaaagggtatgtagaa
tctgtgtttggtaattattggaattatctgcggatttataacccggatattgcccaatta
ttagcgcaaaagaatcagcaaacgccaaagtaa

DBGET integrated database retrieval system