KEGG   Cyanothece sp. PCC 8802: Cyan8802_3711Help
Entry
Cyan8802_3711     CDS       T00968                                 

Definition
(GenBank) ATP synthase F1, beta subunit
  KO
K02112  
F-type H+-transporting ATPase subunit beta [EC:3.6.3.14]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Oxidative phosphorylation
Photosynthesis
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Cyan8802_3711
   00195 Photosynthesis
    Cyan8802_3711
Enzymes [BR:cyh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     Cyan8802_3711
Photosynthesis proteins [BR:cyh00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Cyan8802_3711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3790897..3792348)
Genome map
AA seq 483 aa AA seqDB search
MVAVTEQTNVGKITQVIGPVVDAEFPSGKLPRIYNALKIQGKNPAGNDVSVTCEVQQLLG
DNQVRAVAMSGTDGLVRGMDIVDTGAPISVPVGKVTLGRIFNVLGEPVDEKGDVDMSLTS
PIHRPAPKLIDLETKPKVFETGIKVIDLLTPYRQGGKIGLFGGAGVGKTVIMMELINNIA
INHGGVSVFAGVGERTREGNDLYNEMIESKVINPDNPEESKIALVYGQMNEPPGARMRVG
LSGLTMAEYFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGDLQ
ERITSTKEGSITSVQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLASKGIYPAVDPLDS
TSTMLQPGIVGEEHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRRTVDRARKIERF
LSQPFFVAEVFTGSPGKYVTLKDTIKGFQMILNGELDDLPEQAFYLVGDIEEAKAKAEKL
KKG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggtagccgtaacagaacaaaccaacgttggtaaaatcactcaggtcattggccctgtc
gttgatgccgaatttcccagtggcaagttaccccgaatttataatgccctaaaaattcaa
ggcaaaaatccggccggtaacgatgtctccgtgacctgtgaagtacagcaattattagga
gataaccaagtccgtgccgttgccatgagtggtacagacggcttagttcgcggaatggac
atcgttgataccggagctcccatcagcgttcccgtcggtaaagtcaccctaggtcgcatc
ttcaatgtcctaggagaacccgtagacgaaaaaggtgacgtagatatgagtctaacctcc
cctattcaccgtcctgcgcccaaattaatcgacttagaaaccaaacccaaagtctttgaa
accggtattaaggtgatcgatctgctcactccctaccgtcaaggcggtaaaatcggtctg
tttgggggtgctggtgtgggtaaaaccgtcatcatgatggaattaatcaacaacatcgcg
attaatcacgggggagtctccgtgtttgctggtgtaggggaacgtacccgtgaagggaat
gacctctacaacgaaatgatcgaatctaaggtaattaaccctgataaccctgaagaatcg
aaaattgctctcgtttatggtcagatgaacgaaccccctggagccagaatgcgggtcggt
ttatcgggtttgaccatggccgaatatttccgtgatgtcaacaaacaggacgtactatta
ttcgttgacaatatcttccgcttcgttcaggccggttctgaagtatccgcgctcttagga
cggatgccctctgcggtaggatatcagcccactctaggaacagacgtaggagacttgcaa
gaacgcattacctccaccaaggaaggctctattacctctgttcaagcggtttatgttcct
gcggatgacttaacagatcccgcccctgcgaccaccttcgctcacttagatggaacaacc
gtattatctcgtggcttggcttctaaagggatttatccggcggttgatcccctcgactct
accagtaccatgctacagcctgggattgtgggagaagaacactacaatactgcccgtgcg
gtgcaatctaccctacaacggtacaaagaattacaggatattatcgcaattcttggatta
gacgagctttctgaagaggatcgtcgtaccgtagaccgtgcgcgtaaaatcgagcgtttc
ttgtctcagccgttctttgtagctgaagtcttcacgggttctccgggtaagtatgtcacc
ctcaaagatacgatcaaaggcttccaaatgattctcaatggagaattagacgatttaccc
gaacaggcattttatctggttggggatatcgaagaagccaaagctaaggctgaaaaactc
aaaaaaggctaa

DBGET integrated database retrieval system