KEGG   Cyanothece sp. PCC 8802: Cyan8802_3715Help
Entry
Cyan8802_3715     CDS       T00968                                 

Definition
(GenBank) hypothetical protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3796852..3797097)
Genome map
AA seq 81 aa AA seqDB search
MVIFEPTISLGLIDVSSWQDQVFSMSNHGLVLGHLFAQSVQNVDILADFQKSWKNFIQSG
QVWALGIGFVLGYMFRTFTSS
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggtgatctttgaaccaactatcagtctcggacttatcgatgtctcttcttggcaagat
caggtattttccatgagtaaccacgggttagtcttagggcatctgttcgctcaaagtgta
caaaacgtcgatattctcgctgattttcaaaaatcttggaaaaattttattcagtcaggt
caagtatgggctctaggaatcgggtttgtcctagggtatatgtttcgtacttttaccagt
agctga

DBGET integrated database retrieval system