KEGG   Cyanothece sp. PCC 8802: Cyan8802_3719Help
Entry
Cyan8802_3719     CDS       T00968                                 

Definition
(GenBank) response regulator receiver protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3803146..3803517)
Genome map
AA seq 123 aa AA seqDB search
MKTPKILIIDDEPSILAVVQVSLEILGNWEVLTASTGKDGLEQAKSQQPDIILLDVMMPD
LDGLTVLKELRADPMTQNLGVILLTGKGQLLNEADYYSLKITGIIPKPFDPLTLVEKITI
LSS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccccaaaaattctgattattgacgatgaaccatccattctcgccgttgttcag
gtttctttagaaatcttgggaaattgggaagtattaacggcttctacgggtaaagatgga
ctagagcaagccaaaagtcaacaacctgatatcattcttttagatgttatgatgcccgat
cttgatgggttgacggtactcaaggaattacgcgctgatcccatgactcaaaatcttggg
gttattttattaacaggaaaaggacagttactcaatgaagctgactattattccttaaaa
attacaggaattattcctaaaccttttgatcctttaacattagtcgaaaaaattacgatc
ttgtcctcctaa

DBGET integrated database retrieval system