KEGG   Cyanothece sp. PCC 8802: Cyan8802_3724Help
Entry
Cyan8802_3724     CDS       T00968                                 

Definition
(GenBank) hypothetical protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3808506..3808943
Genome map
AA seq 145 aa AA seqDB search
MTTEQVETNGTQTQEPAKVTTTAKPRTRTTKPKEDNQMTALSVKEKTIHIHGAHGIELIV
EEGNLPGNRPIEASHLKVISTYTSVGGNRPVTASGMDITGTLTISGQRPIMASHLQVSET
YAVMGNRPVAPNEIDDPETLMGFLD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgaacaggtagaaactaacgggacgcaaacgcaagaacccgccaaagtgact
actactgctaaacctcgtactagaacaaccaaacccaaggaagataatcaaatgacagct
ttatccgttaaagaaaaaactattcacattcacggtgctcacggcatagaattaattgta
gaagaaggcaatcttccagggaatcgtccgattgaagcgagtcatcttaaagtcattagt
acctacacttccgtagggggtaatcgtccagtaacagcgagtgggatggatattaccgga
acgttgaccatttctggccagcgtccgattatggccagtcatctacaagttagcgaaacc
tatgcagtgatggggaaccgtcccgttgccccgaatgaaattgatgatcctgagacgtta
atgggatttcttgattaa

DBGET integrated database retrieval system