KEGG   Cyanothece sp. PCC 8802: Cyan8802_3728Help
Entry
Cyan8802_3728     CDS       T00968                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Cyan8802_3728
Enzymes [BR:cyh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Cyan8802_3728
Transfer RNA biogenesis [BR:cyh03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Cyan8802_3728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3815502..3816380)
Genome map
AA seq 292 aa AA seqDB search
MKDSKQTKKLVEIEEIVRSVGWGAAKILRSYYRGEVNQGNLEINHDKTDGPVTAADVAAN
HYILEKLQAVFDSDTFGYLSEETHQGNDRLVQDWVWIIDPLDGTRDFIDKTGEYALHIAL
AYQGRPVVAVVAIPEAEKLYFAAKDHGTFVETADGTVTPIRVSERNQIEDLFLVVSRTHR
DDRFQKLIDSLPLKDRNYMGSVGGKIATILEQKSDVYISLSGKSAAKDWDFAAPELILTE
AGGQFTHFDGRPLTYNNGDVRQWGGLMASNGHCHELLCQQATELLAKIDGDQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagatagcaaacagacgaaaaaattagttgaaattgaagagattgtccgttctgta
ggttggggggcagcgaaaattctgcgttcctactatcgaggggaagttaatcaaggaaat
ttagaaatcaaccacgataaaaccgatggcccagttactgctgctgatgtagcagccaat
cactacattttagagaaattacaggcagtttttgatagtgatacttttggttatcttagt
gaagaaacccaccaaggaaatgatcgccttgttcaagactgggtttggattattgatccc
ctcgatggaacccgtgattttatcgataaaacgggagaatacgcccttcatatagcctta
gcgtatcaaggccgtcctgtggtggctgtagtggctattcctgaagcagaaaagctgtat
tttgcggctaaagatcacggaacttttgtcgagacagccgatggaacagttacaccgatt
cgtgtctcagaacgcaaccaaatagaagatttgtttctcgtggtgagtcgaacccatcgg
gatgatcgctttcaaaagcttattgatagcttacccctaaaagatcgtaattatatggga
agtgttggggggaaaattgctaccattcttgaacaaaaatccgatgtttatatctcctta
tcggggaaatctgccgctaaagattgggattttgctgcccctgaattaattctaacggaa
gcaggagggcaatttactcattttgatggtaggcctttaacctacaataacggagatgtg
aggcaatggggagggttaatggccagtaatggtcattgtcacgaacttttgtgtcaacaa
gccacagaattattagctaaaattgatggagatcagtag

DBGET integrated database retrieval system