KEGG   Cyanothece sp. PCC 8802: Cyan8802_3732Help
Entry
Cyan8802_3732     CDS       T00968                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  
N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Cyan8802_3732
Enzymes [BR:cyh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     Cyan8802_3732
Peptidoglycan biosynthesis and degradation proteins [BR:cyh01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   Cyan8802_3732
Chromosome [BR:cyh03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Cyan8802_3732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3820293..3821309
Genome map
AA seq 338 aa AA seqDB search
MKPIQGIVWGIVTSQTICLSVAANTLQYWDFDVRQNRVEIVTDSDVRPKAQMIANPTRLI
IDLPGVKLSQPSVRQGNITSYVRQVRVGQFSPYTTRIVVELGSAYSMRPWEVKVRSLAPN
RWFVQLSEFQPHSVYSLPPEAEPVAIAVPTPKPYPSTPSGAGYTVVIDPGHGGKDPGAIG
LGGLQEKDVVLSISLQLAEILKKRGVRVIMTRSNDASVSLKGRVEQAETANANVFVSIHA
NAVGGNNSQVNGLETYYYSSGYRLALTIHNNLLRKVNVVDNRGVKQARFYVLRKSSMPAA
LVEVGFVTGSIDNRNLSNPSYRQQLAEAIANGILDYLR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaattcaaggaattgtttggggaatagttacttctcaaacaatttgcctgtct
gttgctgctaatactttgcaatattgggattttgatgtccgtcaaaatcgcgtcgaaatt
gtcaccgatagcgatgtccgtcccaaagcacaaatgatcgccaaccccacccgtctcatt
atcgatttaccaggggtcaaattaagccaacctagtgtccgtcagggaaatattaccagt
tatgtgagacaggttcgcgtcggacaatttagcccctataccacgcgaattgtcgtggaa
ttaggatcagcctattccatgcgtccttgggaggttaaagtccgtagtctagcccctaat
cgctggtttgtccaattatctgaatttcaacctcattcggtctattccctacccccagaa
gcagaaccggtcgcgatcgctgttcctacccctaaaccctatcctagcacaccatcggga
gcgggctacactgttgtcattgaccccggccacggaggaaaagatccaggggcgatcggg
ttaggagggttacaggaaaaagacgttgttttatcaatttcgctacaattggctgaaatc
cttaaaaaacgcggagtcagagtgataatgactcgttcaaatgatgcgtcagtttctcta
aaagggcgtgtcgagcaagcagaaacagccaatgctaacgtatttgtgagtatccatgcg
aatgctgtaggaggaaacaattctcaagtcaatggattagaaacttattattattcttct
gggtatcgattagccttaaccattcataataatcttttaagaaaggtcaatgttgttgat
aatcgtggggtcaaacaagcccgtttttatgtattaagaaaaagttcgatgcccgccgcc
ttggttgaagtcggttttgtcacgggaagtatcgataatcgtaatttatcgaatcctagt
tatcgacaacaattagccgaggcgatcgctaacggtattttagactatttacggtaa

DBGET integrated database retrieval system