KEGG   Cyanothece sp. PCC 8802: Cyan8802_3734Help
Entry
Cyan8802_3734     CDS       T00968                                 

Definition
(GenBank) protein of unknown function DUF1555
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3822566..3823357
Genome map
AA seq 263 aa AA seqDB search
MKNLVRFGVSLPVASILVATSISSAQAAGFTPGDIFSGTGDSFTLTGTTDPTDPALYALF
CDPLIVGPSVGIASGGPTSQCAKIDGSSSSFNVSANPANMTGGFAPFLNADLLARAYSFG
PANTGPTGTNTGSNLVTVFTTSQAGLDLTIKVDTATLVATGAGPGNPVNFFYTGIAEVTG
ADTYSAPITFSFTTQNATLVNNTALVNFVPGQDGGIYDTTIGVNTWSVTVLAVESVPEPS
TLLGLGLLACGGAAGAIKRRLNK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctagtccgttttggtgtttctttgcccgttgctagtattttagtagcaacc
agtatatcttcggcgcaagcagctgggtttactccaggggatatttttagtggaactggc
gattcttttaccctaactggaaccacggatccaactgaccctgctttgtatgcactcttt
tgtgatcccctaattgttggtcctagcgtaggtattgcaagcggtggacccacatcccag
tgtgctaagattgacggcagtagttcatctttcaacgtatctgccaaccctgctaacatg
actggtgggttcgctccctttttgaatgctgatttactcgctcgtgcttatagcttcggt
ccggctaacactggtccgacaggaactaatactggatctaatttggtaactgttttcaca
acgagtcaggctggactagatttaacgattaaagttgacacagcgactctcgtagccaca
ggtgctggaccaggtaatccggttaactttttctatacaggtatagccgaagttactggt
gctgacacctactcagctcccattactttttcattcaccacccaaaacgctaccttggtc
aacaacacagccttggttaacttcgttcctggccaagacggtggaatttatgacacaaca
atcggggtaaacacctggtctgttacagtattagccgtagaatcagtacccgagcctagc
acactccttggtcttggactgttggcttgtggaggtgcggctggagctatcaaacgtcgc
cttaataagtaa

DBGET integrated database retrieval system