KEGG   Cyanothece sp. PCC 8802: Cyan8802_3973Help
Entry
Cyan8802_3973     CDS       T00968                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Cyan8802_3973
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cyan8802_3973
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Cyan8802_3973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4089302..4089799
Genome map
AA seq 165 aa AA seqDB search
MTTAQAPASIYDLSATSINGTPVSLNDYKDKVLLIVNTASQCGFTPQYKGLQALYDQYAS
QGLVVLGFPCNQFGQQEPGTSDQIQSFCEVNFGVSFPLFQKIDVNGSNAHPLYQYLTKAV
PGILGIEAIKWNFTKFLVDRSGKVVKRYPPTTKPEDIAKDIQALL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagcacaagcacctgcctccatttacgacctttctgccaccagtattaatggg
actcccgtgtccttaaacgactacaaagataaagtcttactaatcgtcaataccgccagt
caatgtggctttacacctcaatataagggattacaggcgttatatgaccaatacgccagc
caagggttagtggttttaggctttccctgtaaccaattcggacagcaggaacctggaacc
tccgatcaaattcagtcgttttgtgaagtcaactttggcgtttcctttcccctgtttcag
aaaatcgatgtcaatggcagcaatgcccatccattgtatcagtatttaactaaagctgtc
cctggtattttgggaattgaagccattaagtggaatttcacgaaatttctagttgatcgc
agtggcaaagtcgttaaacgctatcctcccaccaccaaacccgaagatatagccaaagat
attcaagcattactatag

DBGET integrated database retrieval system